KEGG   Synechococcus sp. JA-3-3Ab: CYA_0325Help
Entry
CYA_0325          CDS       T00318                                 

Gene name
gap-2
Definition
(GenBank) glyceraldehyde-3-phosphate dehydrogenase, type I
  KO
K00150  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
cya  Synechococcus sp. JA-3-3Ab
Pathway
cya00010  Glycolysis / Gluconeogenesis
cya00710  Carbon fixation in photosynthetic organisms
cya01100  Metabolic pathways
cya01110  Biosynthesis of secondary metabolites
cya01120  Microbial metabolism in diverse environments
cya01130  Biosynthesis of antibiotics
cya01200  Carbon metabolism
cya01230  Biosynthesis of amino acids
Module
cya_M00002  Glycolysis, core module involving three-carbon compounds
cya_M00165  Reductive pentose phosphate cycle (Calvin cycle)
cya_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
cya_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:cya00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CYA_0325 (gap-2)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    CYA_0325 (gap-2)
Enzymes [BR:cya01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     CYA_0325 (gap-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gp_dh_C Gp_dh_N Band_7_1 GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: ABC98545
CyanoBase: CYA_0325
CYORF: CYA_0325
UniProt: Q2JXE1
Position
342373..343392
Genome map
AA seq 339 aa AA seqDB search
MVRVAINGFGRIGRNFLRCWLGRSQSNLDIVAINDTSDARTAAHLLKYDSILGPLQGAEV
EAVEGGLLVNGKHIHAVSDRNPSNLPWKEWKVDLVIEATGVFVDYQGASKHLEAGAKKVV
ITAPAKGGDIPTFVYGVNQHTYDPVRHNIVSNASCTTNCLAPILKVLLDKFGVLRATMTT
THSYTGDQRILDGGHRDLRRARAAALSMVPTTTGAAKAVALVIPELKGKLNGVAVRVPTP
NVSLVDLVVQTERRVIAEEVNAALKDASETTMKGIIAYSDIPLVSIDYRGHDCSAIVDAE
MTSVLDGDLVKVMAWYDNEWGYSQRVLDLAEYMAAHWVE
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
gtggtcagggtagccatcaacggatttggtcgtatcggtcgcaactttttgcggtgttgg
ctgggtcgctcccagtccaatctcgatattgttgccatcaacgacacatcagacgcccgc
acggctgcccatctgctcaaatacgattccattctcgggccgctgcaaggggcggaagtg
gaggccgtcgagggtggcctgctggttaacggcaagcatatccacgccgtttccgatcgc
aaccccagcaacctgccctggaaagagtggaaggtggatcttgttattgaagctacaggg
gtgttcgtagactatcaaggggcctctaagcaccttgaggcgggagccaaaaaagtagtg
atcaccgctccggccaaggggggcgacattcccacgtttgtatatggcgttaaccaacac
acctatgacccggtgcggcacaacattgtcagcaacgccagttgcaccaccaactgcctt
gcccccatcctcaaagtgttgctggacaagttcggcgtcttgcgggccacgatgaccacc
acccacagctacaccggtgaccagcggattttggatggcggccaccgcgatctgcgacgg
gcgcgggcggcggcgttgagcatggtgcccaccaccaccggggcggccaaggcggtggcg
ctggtgatccccgaactgaagggcaagctgaacggggtggcggtacgggtgcccacgccc
aacgtgtcgctggtggacttggtggtgcaaacggagcggcgcgtgattgccgaggaggtg
aacgcggctctcaaggacgcttcagagaccacgatgaaagggatcattgcctactccgat
atccccttagtctccatcgactaccgcggccacgactgctcggcgattgtggatgccgag
atgaccagcgtgctggacggggatctggtgaaggtgatggcctggtacgacaacgagtgg
ggctactcgcagcgggtgctggatctagctgaatatatggctgctcactgggttgagtag

DBGET integrated database retrieval system