KEGG   Synechococcus sp. JA-3-3Ab: CYA_0325Help
Entry
CYA_0325          CDS       T00318                                 

Gene name
gap-2
Definition
glyceraldehyde-3-phosphate dehydrogenase, type I (EC:1.2.1.-)
Orthology
K00150  
glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
cya  Synechococcus sp. JA-3-3Ab
Pathway
Glycolysis / Gluconeogenesis
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:cya00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CYA_0325 (gap-2)
   01230 Biosynthesis of amino acids
    CYA_0325 (gap-2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CYA_0325 (gap-2)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    CYA_0325 (gap-2)
Enzymes [BR:cya01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     CYA_0325 (gap-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
342373..343392
Genome map
AA seq 339 aa AA seqDB search
MVRVAINGFGRIGRNFLRCWLGRSQSNLDIVAINDTSDARTAAHLLKYDSILGPLQGAEV
EAVEGGLLVNGKHIHAVSDRNPSNLPWKEWKVDLVIEATGVFVDYQGASKHLEAGAKKVV
ITAPAKGGDIPTFVYGVNQHTYDPVRHNIVSNASCTTNCLAPILKVLLDKFGVLRATMTT
THSYTGDQRILDGGHRDLRRARAAALSMVPTTTGAAKAVALVIPELKGKLNGVAVRVPTP
NVSLVDLVVQTERRVIAEEVNAALKDASETTMKGIIAYSDIPLVSIDYRGHDCSAIVDAE
MTSVLDGDLVKVMAWYDNEWGYSQRVLDLAEYMAAHWVE
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
gtggtcagggtagccatcaacggatttggtcgtatcggtcgcaactttttgcggtgttgg
ctgggtcgctcccagtccaatctcgatattgttgccatcaacgacacatcagacgcccgc
acggctgcccatctgctcaaatacgattccattctcgggccgctgcaaggggcggaagtg
gaggccgtcgagggtggcctgctggttaacggcaagcatatccacgccgtttccgatcgc
aaccccagcaacctgccctggaaagagtggaaggtggatcttgttattgaagctacaggg
gtgttcgtagactatcaaggggcctctaagcaccttgaggcgggagccaaaaaagtagtg
atcaccgctccggccaaggggggcgacattcccacgtttgtatatggcgttaaccaacac
acctatgacccggtgcggcacaacattgtcagcaacgccagttgcaccaccaactgcctt
gcccccatcctcaaagtgttgctggacaagttcggcgtcttgcgggccacgatgaccacc
acccacagctacaccggtgaccagcggattttggatggcggccaccgcgatctgcgacgg
gcgcgggcggcggcgttgagcatggtgcccaccaccaccggggcggccaaggcggtggcg
ctggtgatccccgaactgaagggcaagctgaacggggtggcggtacgggtgcccacgccc
aacgtgtcgctggtggacttggtggtgcaaacggagcggcgcgtgattgccgaggaggtg
aacgcggctctcaaggacgcttcagagaccacgatgaaagggatcattgcctactccgat
atccccttagtctccatcgactaccgcggccacgactgctcggcgattgtggatgccgag
atgaccagcgtgctggacggggatctggtgaaggtgatggcctggtacgacaacgagtgg
ggctactcgcagcgggtgctggatctagctgaatatatggctgctcactgggttgagtag

DBGET integrated database retrieval system