KEGG   Synechococcus sp. JA-3-3Ab: CYA_0398Help
Entry
CYA_0398          CDS       T00318                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cya  Synechococcus sp. JA-3-3Ab
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cya00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CYA_0398 (tpiA)
   01230 Biosynthesis of amino acids
    CYA_0398 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CYA_0398 (tpiA)
   00051 Fructose and mannose metabolism
    CYA_0398 (tpiA)
   00562 Inositol phosphate metabolism
    CYA_0398 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    CYA_0398 (tpiA)
Enzymes [BR:cya01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CYA_0398 (tpiA)
Exosome [BR:cya04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CYA_0398 (tpiA)
  Exosomal proteins of bladder cancer cells
   CYA_0398 (tpiA)
  Exosomal proteins of melanoma cells
   CYA_0398 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
CyanoBase: 
CYORF: 
UniProt: 
Position
412218..412985
Genome map
AA seq 255 aa AA seqDB search
MRPILIAGNWKMHKTQAEARQFLREFRPALQASSAGVRPQRQIILCVPFTDLAVVVEETR
GSGMAVGAQNLHWEDQGAFTGEISGPMLAELGVRYVIVGHSERRQYFGETDETVNRRLAA
AQRHGLTPILCVGESLQQREQGLTESWIVGQLDRALPGIDLRNLVIAYEPIWAIGTGKTC
AAAEANRVIGLIRQHLGADHLPILYGGSVKASNIDELMAQPQIDGVLVGGASLDPQEFAR
IVNFQALTPAAAAAP
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
ttgcgccccatcctcattgccggcaactggaaaatgcacaagactcaggctgaggctcgc
cagtttctgcgcgagtttcgtccagccctgcaagcctcgtctgcaggggtgaggccgcag
cggcagatcattctctgcgtgcccttcacagacctggccgtggtggtagaagaaacgcgg
ggatccggcatggctgtgggagcccagaacctgcactgggaggatcaaggggcgtttacg
ggagagatctccggccccatgctggcagagctgggggtgcgctacgttatcgtcggccac
agcgaacggcggcagtactttggcgaaaccgatgaaaccgtcaaccggcgcttggccgcg
gcccagcggcacgggctcacccccatcctctgtgtgggggaaagcttgcaacagcgggag
caaggcctgaccgagtcttggattgtgggacagttggatcgcgccttgccggggatcgat
ctgcgcaacctcgtgattgcctacgagccaatctgggccattggcacggggaaaacctgt
gcagccgccgaggccaaccgcgtcatcggccttatccgccagcatctgggcgccgaccac
ctgcccatcctctacggtggctcggtcaaagccagcaacatcgacgagctgatggcccag
ccgcagattgacggtgtactggtgggaggggccagcctcgatccccaagagtttgcccgc
attgtcaacttccaggccctgactcctgccgcagcagcggctccctag

DBGET integrated database retrieval system