KEGG   Synechococcus sp. JA-3-3Ab: CYA_0473Help
Entry
CYA_0473          CDS       T00318                                 

Gene name
adhE
Definition
(GenBank) aldehyde-alcohol dehydrogenase
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
cya  Synechococcus sp. JA-3-3Ab
Pathway
cya00010  Glycolysis / Gluconeogenesis
cya00071  Fatty acid degradation
cya00350  Tyrosine metabolism
cya00620  Pyruvate metabolism
cya00625  Chloroalkane and chloroalkene degradation
cya00626  Naphthalene degradation
cya00650  Butanoate metabolism
cya01100  Metabolic pathways
cya01110  Biosynthesis of secondary metabolites
cya01120  Microbial metabolism in diverse environments
cya01130  Biosynthesis of antibiotics
cya01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cya00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CYA_0473 (adhE)
   00620 Pyruvate metabolism
    CYA_0473 (adhE)
   00650 Butanoate metabolism
    CYA_0473 (adhE)
  Lipid metabolism
   00071 Fatty acid degradation
    CYA_0473 (adhE)
  Amino acid metabolism
   00350 Tyrosine metabolism
    CYA_0473 (adhE)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CYA_0473 (adhE)
   00626 Naphthalene degradation
    CYA_0473 (adhE)
Enzymes [BR:cya01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     CYA_0473 (adhE)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     CYA_0473 (adhE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: ABC98691
CyanoBase: CYA_0473
CYORF: CYA_0473
UniProt: Q2JX05
Position
complement(489057..491687)
Genome map
AA seq 876 aa AA seqDB search
MPVTNLEELEALIQQVKAAQAEYATFTQEQVDRIFHKAALAANNERIPLAKLAVEETGMG
IVEDKVIKNHFASEYIYNKYKHEKTCGVIERDESFGYERIAEPVGLLAGIVPVTNPTSTT
IFKALITLKTRNAIIFSPHPRAKRCTIAAAKVVKEAAEAAGAPVGLIGWIDEPTIELSQA
LMQHPEVKLILATGGPGMVKAAYSSGHPSLGVGAGNTPAVIDASADIPTAVSSILLSKTF
DNGMICASEQAVIVVEAVYEQVKAEFCHRGAYFLDPEQTQAVRRILLKDGRLNPAIVGQS
VQTIAALAGIQVPEGSKLLIGEVEKVGPEEPFSYEKLAPVLALYRAKDFPSAVDMAVQVV
NFGGRGHTSVLYTDPANRDDIAYFENALQTARVLINTPSSQGAIGDLYNFRLDPSLTLGC
GTWGGNSVSDNVGPRHLLNIKTVAYRRENMLWFRVPPKIYFKPGCLPVALRELAGKKRAF
LVTDRPLFELGVLQAVTRVLDELQIKWDVYHDVEPDPTLSAVNRGLEQLRQFQPDVIIAV
GGGSPMDAAKVMWLMYEQPQLEFEGLATRFMDIRKRVYELPPLGQKAQLVCIPTTSGTGS
EVTPFAVVTDDRVGIKYPLADYALTPSMAIVDPDLTLKMPKKLTAYGGLDALTHALEAYV
SVMASEFTDGLALQAIKLLMTYLPRAYEKGAEDPEAREKVHYAATIAGMAFANAFLGVCH
SLAHKLGSTFHLPHGLANALMITHVIRYNATDAPFKQAIFPQYRYPNAKHRYAEIADYLQ
LGGANDDEKVMRLIEAIEELKRKLGIPATIREALSESEQAFYDRLEAMAEQAFDDQCTGA
NPRYPLIQDMKELYVLAYRGCRVEAALYHQPEPVLA
NT seq 2631 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtcaccaacctcgaggaactggaagctctgatccaacaggtaaaagctgcccag
gctgagtatgccaccttcacccaggaacaggtggatcggatctttcacaaagctgccctg
gccgccaacaacgaacggatcccgctggccaagctggccgtggaagagaccggcatgggg
attgtggaagacaaggtgatcaaaaatcactttgcctctgaatacatttacaacaaatac
aaacacgagaaaacctgtggcgtcatcgagcgggacgagagttttggctacgagcgcatt
gccgagccggtggggcttttggcgggcattgtgccagtcaccaaccccacttcgacaacc
attttcaaagctctcatcaccctgaaaacccgcaacgccatcatcttttcccctcacccc
cgcgccaaacgatgcaccattgccgcggccaaggtggtcaaggaggcggctgaggcagcc
ggtgcgcctgtggggttgatcggctggatcgacgagcccaccatcgagctgtctcaggct
ttgatgcaacatccggaggtgaagttgatcctggccaccgggggccctggcatggtcaag
gcggcctattcctccggccacccctcgctgggtgtgggggcgggcaacacgccggcggtg
atcgacgccagcgccgacattcccacagctgtcagctcgatcttgctcagcaaaactttt
gacaacggcatgatctgcgcctcggaacaggcggtgatcgtggtggaggccgtttatgag
caggtgaaggcggagttttgccatcgaggggcctactttttggatccggaacagacgcaa
gcggtgcgccgcattctcctcaaggatggccgtctcaatccagctattgttggccaatcg
gtgcagaccatcgctgctctggccgggatccaggtacccgaaggcagcaagctgctgatt
ggggaagtggagaaggtggggcccgaagagccgttttcctacgaaaaattggctcctgtt
ttggccctctaccgcgccaaggatttccccagcgctgtcgatatggccgtccaagtggtc
aatttcggggggcggggccacacctctgttttgtataccgatcccgccaatcgggacgat
attgcctactttgaaaatgccctacaaacagcgcgggtgctgatcaacaccccctcttcc
cagggagcaattggggatctctataacttcaggctggatccctcgctcaccctaggctgt
ggcacttgggggggcaattcggtctcggacaatgtggggccgcgccacctgctcaacatt
aaaacggtggcctaccggcgggaaaatatgctctggtttcgggtgccgcccaagatctac
ttcaagccgggatgtctaccggtggcgctgcgggagttggccggcaaaaaacgggctttt
ttggttaccgataggcccctcttcgagctgggcgtgctgcaggcggttacccgggttttg
gacgaactgcagatcaagtgggatgtctaccacgacgtggagccggatcccaccctcagc
gccgtcaaccgcggcctggagcagctgcgccagtttcagccggatgtcatcatcgccgtg
ggcggcggatcccccatggacgcggccaaggtgatgtggctgatgtacgagcagccccag
ctggagtttgaaggcctggccacgcgctttatggacatccgcaagcgggtctacgagctg
ccgccgctggggcaaaaagcccaactggtctgcatccccaccacttccgggacgggatcc
gaggtgacgccctttgccgtagtcaccgacgaccgggtggggatcaagtacccactggcc
gactacgccctcacccccagcatggccattgtggatccggatctcactttgaagatgccc
aagaagctaaccgcctacggcggcctcgatgcccttacccatgccctggaagcctatgtc
tcggtgatggccagcgagtttaccgatgggctggcgctgcaggcgattaagctgctgatg
acctacctgccgcgggcctacgagaagggggccgaagatccagaagccagagaaaaagtc
cactacgccgccaccattgccggcatggcctttgccaacgcctttttgggggtgtgccac
tccttggcccacaagctgggatccaccttccacctgccccacggcctggccaatgccctg
atgattacccacgtcatccgctacaacgccaccgacgccccctttaagcaggccatcttc
ccccaataccgctaccccaacgccaagcaccgctatgccgagattgccgattacctgcag
ttgggcggagccaatgatgatgaaaaggtcatgcgcctcattgaggccatcgaggagcta
aagcggaagctagggatcccggctaccatccgcgaggccctcagcgagagcgagcaggcg
ttctacgaccgtctggaggcgatggcggagcaggctttcgatgatcaatgcaccggcgcc
aacccccgctacccgctgattcaggacatgaaggagctgtacgtcttggcctaccggggc
tgccgggtggaggctgccctctaccaccagccggagccggtgttggcctag

DBGET integrated database retrieval system