KEGG   Synechococcus sp. JA-3-3Ab: CYA_0490Help
Entry
CYA_0490          CDS       T00318                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
cya  Synechococcus sp. JA-3-3Ab
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cya00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CYA_0490 (ruvA)
Enzymes [BR:cya01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     CYA_0490 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
CyanoBase: 
CYORF: 
UniProt: 
Position
507552..508166
Genome map
AA seq 204 aa AA seqDB search
MIAFLSGHLVAIEWGERSSLTVEVQGIGYRVKAPARFLKQLPPIGEPVRVFTHLVVRETE
LVLYGFGSPAERDVFVELIKVSGVGPALGLALLNTFGLPELVQAVVTENVRLLSLTPGVG
HKTAQRLALELKTKLAHWRQGLENADRPLAGGPPPAIREEVEMALLALGYSLQEIQAALQ
ALPSQPRPTEEWLRDAITYLSRQP
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcgtttttgagcggccacctcgtcgccatcgaatggggagagcgcagtagcctc
accgttgaggtgcaggggatcggctatcgggtcaaggccccggcgcgttttctcaagcaa
ctgccccccatcggagagcccgtgcgggtgtttacccacttggtggtgcgagagaccgag
ctggtgttgtacgggtttggctcgccagccgagcgcgatgtgtttgtggagctcatcaaa
gtttcgggggtggggccggctttgggcttggctctgctgaataccttcggcctgccggag
ctggttcaggcagtggtgaccgaaaacgtgcgcctactttccctcacgccaggggtaggg
cacaaaacggcccaacggctagccttggagctgaaaaccaagctggcccactggcgacaa
ggcctggagaacgccgatcgccccctggccggcgggccgcctccggccatccgggaagag
gtggaaatggccttgctggccctcggctacagcctccaagaaattcaagcggccctgcaa
gctttgccctcccaaccccgcccaacggaagagtggctgcgggatgccatcacctacctc
agccggcagccatga

DBGET integrated database retrieval system