KEGG   Synechococcus sp. JA-3-3Ab: CYA_0529Help
Entry
CYA_0529          CDS       T00318                                 

Gene name
cobA_hemD
Definition
uroporphyrin-III C-methyltransferase/uroporphyrinogen-III synthase (EC:2.1.1.107 4.2.1.75)
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
cya  Synechococcus sp. JA-3-3Ab
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cya00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CYA_0529 (cobA_hemD)
Enzymes [BR:cya01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     CYA_0529 (cobA_hemD)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     CYA_0529 (cobA_hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
CyanoBase: 
CYORF: 
UniProt: 
Position
544262..545764
Genome map
AA seq 500 aa AA seqDB search
MGKVYLVGAGLGGRAGLTQGALEILRRAEAVWVDELVDERLLAELPAQAQVWRRSGAAGL
QEGLRWLIQRCREGKQVVHLKAGDPLIFGRAREEVQALREAGCPFEIWPGLSSALAGPLW
AGIPLTDKHLSRAFAVLTAHELEALPWSALAQLDTLVILMGSRQRQQIAAQLMAAGIPPE
RAAALIWGAGQAEQRVWVGTLAELQQGEGPEAGEKLPGLLVVGEVVRLRQEFLPGIPPLP
PPAPLAGKTVLVTRAEGQSPAFRELLRAQGARVLEMPALVIQPPSSWDPLDAAIANLEKF
DWLLLTSANGVQAFFERLQQQGRDSRALHSLQVAVVGAKTAAALAQYGIRPDLMPSAFVA
EALLPIWPEPVQGQRILFPRVESGGREELVQGLRQRGAEVVEVAAYQSTCPAAADPQVLE
ALKTRQVDILTFASSKTVQHFAHLLRQAGLGPEVWDPPVQIAAIGPKTAATCRQILGRVD
VVAQEYTLEGLVGSLLQTVP
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaggtgtatctggtgggcgcggggctgggcgggcgggcgggcctgacgcaaggg
gcgttggagatcctgcggcgggccgaggcagtctgggtggacgagctggtggacgagcgc
ttgttggcggagctccccgcccaagcgcaggtgtggcgacgttcaggagcagcgggtttg
caggagggccttcgctggctcatccagcgctgccgcgagggcaagcaggtggttcacctc
aaggcgggggatcccttgatctttggccgtgcccgcgaggaggtgcaggccctgcgggag
gcgggctgcccgtttgagatctggccaggtctatcttcggccttggccggccccctgtgg
gcggggatccccctgacggacaagcacttgagccgcgcctttgccgtgctgacggcccac
gagctggaggccctgccctggagcgccctggcccagttggatacgttggttattttgatg
ggatcccggcagcggcagcagattgcggcccagttgatggcagcggggatcccgccggag
cgagcggcggccctgatctggggggcggggcaggcggagcagcgggtttgggtgggcacc
ctggcagagctgcaacagggggaagggccagaagctggggagaagttgcccggcctgctg
gtggtgggcgaggtggtgcggctgcggcaggaatttttgccggggatcccaccgttgccg
ccaccggctcctttggcaggcaagacggtgctggtcacccgtgctgaggggcagtcgccg
gcttttcgcgagctgctgcgggctcagggggcgcgggtgttggagatgcctgccctggtc
atccagccgcctagcagttgggatcccttggacgcggccattgccaacctggagaagttc
gactggctgctgctgacttcggccaatggggtgcaggctttcttcgagcggctgcagcag
caggggcgagacagccgggcgctccactccctgcaagtggcggtggtgggagccaaaaca
gcggcggcgctagcgcagtacggcatccgcccagatttgatgccctccgcgtttgtggcc
gaagccttgctgcccatttggccagagccggtgcaggggcagcgcatcctctttccccgc
gtcgaatccggaggacgggaggagctggtgcaggggctgcggcaacgcggagctgaggtg
gtggaggtggctgcctatcaatcgacctgtccggcagcggcggatccccaagtcctggaa
gccctaaagacccgccaggtggatattctcacctttgccagctccaaaacggtgcagcat
tttgcccatctcctgcgccaggcagggctaggccctgaggtctgggatccgccggtgcag
attgcggccattggccccaaaacggcggcaacctgcaggcagatcttggggcgggtagat
gtggtggcccaggagtacaccctggaagggctggtgggatccctcctgcagactgtcccc
tag

DBGET integrated database retrieval system