KEGG   Synechococcus sp. JA-3-3Ab: CYA_0535Help
Entry
CYA_0535          CDS       T00318                                 

Definition
arginase family protein
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
cya  Synechococcus sp. JA-3-3Ab
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:cya00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    CYA_0535
Enzymes [BR:cya01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     CYA_0535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(550816..551700)
Genome map
AA seq 294 aa AA seqDB search
MAQWSLHPSSQSNARVVLIPTAFGPDTQAPLAILNAGAELCAFEPRLGINVDEIAVAQLP
GLVDEPPYGMCEAAVIQAWRRQQWPVLLPSVLAASWGAIRALWKHYLALSVVHCSAHANL
MPPEEMTQPEQDMGYGNAAWVELLYQHRLPVVHVGLRSGSARAYAWLKNHASPIFWAQDG
WDPQQVVEALPEQPVFLVVDCSVLDPSLAPAVHHPEPGGLSWFQLLTTCEAIFAARPVIG
LSLGGVAVGAATRPTARVVARLLNWLLACYGLYSLKLAPNPATLERPENRSRTS
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atggcccagtggtccctccatcccagttcccagtccaacgccagggttgtcctcattccc
actgcctttggcccagatacgcaggcgccgctggccatcctcaacgccggtgctgagctg
tgtgcttttgagccgcggttggggatcaatgtggatgagatagcagtggcgcagttgccg
gggctggtggatgagccgccctatggcatgtgtgaggcggcggttattcaggcttggcga
cgacaacagtggccggtgctgttgccttcggtcttggcggccagttggggagccattcgt
gccctttggaagcactacctcgccctgagtgtggtgcattgcagcgcccatgccaacctg
atgccgcccgaggagatgacccagccggagcaagatatgggctatggcaacgctgcctgg
gtggagttgctctaccagcataggctgccggtggtgcatgtggggctgcgcagcggcagt
gcccgcgcctacgcctggctgaaaaaccacgccagcccgatcttttgggcccaggatggc
tgggatccgcagcaggtggtggaggctttgccggagcagccggtgtttttggtggtggac
tgcagtgtgctggatccctctttggcgccggcggtgcaccacccggagccgggggggctg
agttggtttcaactgttaacaacctgtgaggccatcttcgccgcccgccctgtgatcggc
ctttccttgggaggagtggcggtgggagcggcgacgcggccaaccgcccgcgtggtggcc
cgcctgctcaattggctgctggcctgctacggcctctactccctgaagctggcccccaac
cccgctacgctcgaacggcccgaaaatagatcgcgaacctcttga

DBGET integrated database retrieval system