KEGG   Synechococcus sp. JA-3-3Ab: CYA_0742Help
Entry
CYA_0742          CDS       T00318                                 

Definition
branched-chain alpha-keto acid dehydrogenase subunit E2
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cya  Synechococcus sp. JA-3-3Ab
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cya00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CYA_0742
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CYA_0742
   00020 Citrate cycle (TCA cycle)
    CYA_0742
   00620 Pyruvate metabolism
    CYA_0742
Enzymes [BR:cya01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     CYA_0742
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
749181..750440
Genome map
AA seq 419 aa AA seqDB search
MIHELSMPALSSTMETGKIVAWLKNPGDRVEKGENILVVESDKADMDVESFHSGILASIL
IPAGESAPVGAPIALIAETEAEVAEAQERAKALSKGALPATAPTAVPTPTVQQPTPVPAA
IPTPTLPTGSNGAGSQRILASPRAKKLAESLGIDLRTVRGSGPGGRIVAEDVERAAAQAA
STQAAAPPPVSAAAPLGEVVPLSTLQAAVVRNMNASLGVPVFHVGYTITTDSLDQLYQQV
KPKGVTLTALLVKAVALTLEKHPLLNASYTENGIHYKAEINIAVAVAMEDGGLITPVLKQ
ANRVDLYELSRRWKELVERARRKQLQPEEYNSGTFTLSNLGMFGVDRFDAILPPNQGAIL
AVGAARPTVVATPEKAIAIRSQMQVNLTCDHRVIYGAHAAAFLQDLAQLLEQKVGSLTL
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgatccacgaactctccatgccggccctcagctccaccatggaaacgggcaagatcgtc
gcctggctgaaaaaccccggcgaccgggtggagaaaggggaaaacatcctggtggtggag
tcggacaaggcggacatggacgtggagtccttccacagcggcattctggccagcatcctc
atcccagcaggggaatcggcgccggtgggcgcccccatcgccctcattgccgaaaccgaa
gcggaggtggccgaggcccaagagcgagccaaggccctctctaagggtgctctaccggca
actgcacctactgcagtccccacccccacagttcaacagccaacccctgtccctgcggcg
atccccacccccacccttccaactggctccaacggggccggatcccagcggatcctggct
tccccacgggcgaaaaaattggcagaaagcctggggatcgacctgcgcacggtgcgcggc
tccggccctggtgggcgcatcgtggccgaagatgtggagcgggctgcagctcaggccgcc
tctacgcaagcggcagctcccccccctgtctctgcggctgccccgttgggagaagtggtt
cccttgagcacgttgcaggcggcggtggtgcgcaacatgaacgccagcttgggcgtgccg
gtgttccacgtcggctacaccatcaccaccgacagcctggatcagctttaccaacaggtg
aagcccaaaggggtaaccctgacggcccttttggtgaaagcggtggccctgaccctagaa
aagcatcccctcctcaacgccagctacacggaaaacgggatccactacaaagccgagatc
aacattgccgtggcggtggccatggaagacggcggcctgatcacccctgtgctcaagcag
gccaaccgcgttgacctgtacgaactctcacggcgttggaaggagctggtggagcgggcg
cggcgcaagcaactgcagccggaggagtacaacagcggcacctttaccctctccaacctg
ggcatgtttggggtggatcgcttcgacgccatcctgcctcccaaccaaggagctattttg
gccgtcggcgctgctcgccccaccgtggtggccacaccagaaaaagccatcgccatccgc
tcccagatgcaggtcaacctcacctgcgaccaccgcgtcatttacggcgcccacgctgcg
gccttcttgcaagatctggcccagttgttagaacaaaaggtgggatccctgacgctgtag

DBGET integrated database retrieval system