KEGG   Synechococcus sp. JA-3-3Ab: CYA_0742Help
Entry
CYA_0742          CDS       T00318                                 

Definition
(GenBank) putative 2-oxo acid dehydrogenase, acyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cya  Synechococcus sp. JA-3-3Ab
Pathway
cya00010  Glycolysis / Gluconeogenesis
cya00020  Citrate cycle (TCA cycle)
cya00620  Pyruvate metabolism
cya01100  Metabolic pathways
cya01110  Biosynthesis of secondary metabolites
cya01120  Microbial metabolism in diverse environments
cya01130  Biosynthesis of antibiotics
cya01200  Carbon metabolism
Module
cya_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cya00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CYA_0742
   00020 Citrate cycle (TCA cycle)
    CYA_0742
   00620 Pyruvate metabolism
    CYA_0742
Enzymes [BR:cya01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     CYA_0742
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding AATase MadL
Motif
Other DBs
NCBI-ProteinID: ABC98952
CyanoBase: CYA_0742
CYORF: CYA_0742
UniProt: Q2JWB6
Position
749181..750440
Genome map
AA seq 419 aa AA seqDB search
MIHELSMPALSSTMETGKIVAWLKNPGDRVEKGENILVVESDKADMDVESFHSGILASIL
IPAGESAPVGAPIALIAETEAEVAEAQERAKALSKGALPATAPTAVPTPTVQQPTPVPAA
IPTPTLPTGSNGAGSQRILASPRAKKLAESLGIDLRTVRGSGPGGRIVAEDVERAAAQAA
STQAAAPPPVSAAAPLGEVVPLSTLQAAVVRNMNASLGVPVFHVGYTITTDSLDQLYQQV
KPKGVTLTALLVKAVALTLEKHPLLNASYTENGIHYKAEINIAVAVAMEDGGLITPVLKQ
ANRVDLYELSRRWKELVERARRKQLQPEEYNSGTFTLSNLGMFGVDRFDAILPPNQGAIL
AVGAARPTVVATPEKAIAIRSQMQVNLTCDHRVIYGAHAAAFLQDLAQLLEQKVGSLTL
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgatccacgaactctccatgccggccctcagctccaccatggaaacgggcaagatcgtc
gcctggctgaaaaaccccggcgaccgggtggagaaaggggaaaacatcctggtggtggag
tcggacaaggcggacatggacgtggagtccttccacagcggcattctggccagcatcctc
atcccagcaggggaatcggcgccggtgggcgcccccatcgccctcattgccgaaaccgaa
gcggaggtggccgaggcccaagagcgagccaaggccctctctaagggtgctctaccggca
actgcacctactgcagtccccacccccacagttcaacagccaacccctgtccctgcggcg
atccccacccccacccttccaactggctccaacggggccggatcccagcggatcctggct
tccccacgggcgaaaaaattggcagaaagcctggggatcgacctgcgcacggtgcgcggc
tccggccctggtgggcgcatcgtggccgaagatgtggagcgggctgcagctcaggccgcc
tctacgcaagcggcagctcccccccctgtctctgcggctgccccgttgggagaagtggtt
cccttgagcacgttgcaggcggcggtggtgcgcaacatgaacgccagcttgggcgtgccg
gtgttccacgtcggctacaccatcaccaccgacagcctggatcagctttaccaacaggtg
aagcccaaaggggtaaccctgacggcccttttggtgaaagcggtggccctgaccctagaa
aagcatcccctcctcaacgccagctacacggaaaacgggatccactacaaagccgagatc
aacattgccgtggcggtggccatggaagacggcggcctgatcacccctgtgctcaagcag
gccaaccgcgttgacctgtacgaactctcacggcgttggaaggagctggtggagcgggcg
cggcgcaagcaactgcagccggaggagtacaacagcggcacctttaccctctccaacctg
ggcatgtttggggtggatcgcttcgacgccatcctgcctcccaaccaaggagctattttg
gccgtcggcgctgctcgccccaccgtggtggccacaccagaaaaagccatcgccatccgc
tcccagatgcaggtcaacctcacctgcgaccaccgcgtcatttacggcgcccacgctgcg
gccttcttgcaagatctggcccagttgttagaacaaaaggtgggatccctgacgctgtag

DBGET integrated database retrieval system