KEGG   Synechococcus sp. JA-3-3Ab: CYA_0781Help
Entry
CYA_0781          CDS       T00318                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
cya  Synechococcus sp. JA-3-3Ab
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cya00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:cya00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:cya02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(785884..787233)
Genome map
AA seq 449 aa AA seqDB search
MLATRSYSLRAALAATLCLLSSSVFSSSVAQAAPKPTGNGAIFFHPDGTSASHWDITRIL
YYGPDGFLNWDRLPVIAPYRGHLLDQLGGTSNAGAVTHATGTRVHAKSFGLDPDGKEYPS
ANGTLNTIMEEAVAAGLGTALVQTGSIIEPGTAAFVAEVAKRSDYEEIALQVVESGVDII
LGAGEEWLLPEGVQGRFGKGKRKDGRNLIEEAKKKGYAVVYTRDELLKLPADVSKVLGVF
NVEDTFYDKPEEELRKENLPNYIASAPTIAEMTEFALARISRNPKGFFAVIEEEGTDNMC
NNLNASGCLEAMKRADDAIGVILNFIEKNPKTFMITTSDSNAGGMQLVDVESADEPLPPT
DPEGSGAPIDGVDGTGTKPFISAPDKNGKRFPFAVAWATGDDVGSGVIARAAGLKAQELV
PTTGILNTDIYRILYFVLFGEQIPSELKP
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
gtgttagctacgcgtagctattctctgagggcagcgttggctgcaactttgtgtctgctg
tcctcgtcagttttttcctccagtgtggctcaagcggcgcctaagccaaccggcaacggt
gcaatcttctttcacccagatggaacctcagcttcccactgggacatcacacgcattctc
tactacggccccgatggctttctgaactgggatcgtctccccgtgattgccccctatcgc
gggcaccttctcgaccagcttgggggaacttccaacgccggagcggtgacccatgccacg
ggaacccgtgtccacgccaagagctttgggttggatccggacggcaaagagtacccctct
gccaacggcaccctgaacacgatcatggaagaggccgtggcggcaggcttgggtacggct
ctggtgcaaacgggatccatcattgagccggggacagctgccttcgttgccgaagttgcc
aagcgcagcgactatgaggagattgccctgcaggtggtggagtcaggggtagacatcatc
ctcggcgctggcgaggaatggctgctgccggaaggtgtccagggccgctttggcaaaggg
aagcgcaaggatggccgcaacctgattgaggaggccaagaaaaaggggtacgccgttgtc
tacacccgcgacgagctgctcaagctgccggcagatgtctccaaagttttgggggtgttc
aacgtcgaggacaccttctacgacaagcctgaagaagagttgcggaaagaaaacttgccc
aactacatcgccagcgcccccaccattgccgagatgaccgaatttgccctggcgcggatc
tcccgcaatcctaagggcttcttcgccgtcatcgaagaagagggcactgataacatgtgc
aacaacctcaatgcctctggctgcctggaggccatgaagcgggccgacgatgccatcggg
gtgattctcaactttatcgagaagaatcccaagaccttcatgatcaccaccagcgacagc
aatgccggtggcatgcagttggtggatgtcgagtccgccgatgagccgttgccccctact
gaccccgaaggcagtggtgcccccattgacggagttgacggcacgggcacaaagccgttt
atttctgctcctgacaagaatggcaagcgctttccctttgccgtggcttgggctaccgga
gatgacgtgggcagcggcgtcatcgctcgcgctgcgggcttgaaggcccaagagctggtg
ccgaccaccgggatcctgaacacggacatttatcggattctctacttcgtgctcttcggg
gagcagatccccagcgagctcaagccgtag

DBGET integrated database retrieval system