KEGG   Synechococcus sp. JA-3-3Ab: CYA_0781Help
Entry
CYA_0781          CDS       T00318                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
cya  Synechococcus sp. JA-3-3Ab
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:cya00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CYA_0781
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    CYA_0781
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    CYA_0781
Enzymes [BR:cya01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     CYA_0781
Exosome [BR:cya04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CYA_0781
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(785884..787233)
Genome map
AA seq 449 aa AA seqDB search
MLATRSYSLRAALAATLCLLSSSVFSSSVAQAAPKPTGNGAIFFHPDGTSASHWDITRIL
YYGPDGFLNWDRLPVIAPYRGHLLDQLGGTSNAGAVTHATGTRVHAKSFGLDPDGKEYPS
ANGTLNTIMEEAVAAGLGTALVQTGSIIEPGTAAFVAEVAKRSDYEEIALQVVESGVDII
LGAGEEWLLPEGVQGRFGKGKRKDGRNLIEEAKKKGYAVVYTRDELLKLPADVSKVLGVF
NVEDTFYDKPEEELRKENLPNYIASAPTIAEMTEFALARISRNPKGFFAVIEEEGTDNMC
NNLNASGCLEAMKRADDAIGVILNFIEKNPKTFMITTSDSNAGGMQLVDVESADEPLPPT
DPEGSGAPIDGVDGTGTKPFISAPDKNGKRFPFAVAWATGDDVGSGVIARAAGLKAQELV
PTTGILNTDIYRILYFVLFGEQIPSELKP
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
gtgttagctacgcgtagctattctctgagggcagcgttggctgcaactttgtgtctgctg
tcctcgtcagttttttcctccagtgtggctcaagcggcgcctaagccaaccggcaacggt
gcaatcttctttcacccagatggaacctcagcttcccactgggacatcacacgcattctc
tactacggccccgatggctttctgaactgggatcgtctccccgtgattgccccctatcgc
gggcaccttctcgaccagcttgggggaacttccaacgccggagcggtgacccatgccacg
ggaacccgtgtccacgccaagagctttgggttggatccggacggcaaagagtacccctct
gccaacggcaccctgaacacgatcatggaagaggccgtggcggcaggcttgggtacggct
ctggtgcaaacgggatccatcattgagccggggacagctgccttcgttgccgaagttgcc
aagcgcagcgactatgaggagattgccctgcaggtggtggagtcaggggtagacatcatc
ctcggcgctggcgaggaatggctgctgccggaaggtgtccagggccgctttggcaaaggg
aagcgcaaggatggccgcaacctgattgaggaggccaagaaaaaggggtacgccgttgtc
tacacccgcgacgagctgctcaagctgccggcagatgtctccaaagttttgggggtgttc
aacgtcgaggacaccttctacgacaagcctgaagaagagttgcggaaagaaaacttgccc
aactacatcgccagcgcccccaccattgccgagatgaccgaatttgccctggcgcggatc
tcccgcaatcctaagggcttcttcgccgtcatcgaagaagagggcactgataacatgtgc
aacaacctcaatgcctctggctgcctggaggccatgaagcgggccgacgatgccatcggg
gtgattctcaactttatcgagaagaatcccaagaccttcatgatcaccaccagcgacagc
aatgccggtggcatgcagttggtggatgtcgagtccgccgatgagccgttgccccctact
gaccccgaaggcagtggtgcccccattgacggagttgacggcacgggcacaaagccgttt
atttctgctcctgacaagaatggcaagcgctttccctttgccgtggcttgggctaccgga
gatgacgtgggcagcggcgtcatcgctcgcgctgcgggcttgaaggcccaagagctggtg
ccgaccaccgggatcctgaacacggacatttatcggattctctacttcgtgctcttcggg
gagcagatccccagcgagctcaagccgtag

DBGET integrated database retrieval system