KEGG   Synechococcus sp. JA-3-3Ab: CYA_0908Help
Entry
CYA_0908          CDS       T00318                                 

Gene name
pcm
Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
cya  Synechococcus sp. JA-3-3Ab
Brite
Enzymes [BR:cya01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     CYA_0908 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(917990..918616)
Genome map
AA seq 208 aa AA seqDB search
MDPWAGQRERMVREQILQRGIRDPRVLEAMRKVPRHLFVPPELRERAYRDCPLPIGYGQT
ISQPYIVAFMTEAARLTPESVVLEIGTGSGYQAAILAELARQVYSLERLAPLAARAQQTL
ASLGYRNVEVRQGDGYQGWPEHAPYDAIVVTAAPPTLPTLLLDQLAVGGTLVVPVGESQG
FQSLLILHKTPEGVVQKGAFPVQFVPMV
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atggatccctgggctggccaacgggagcggatggtgagggagcagatcttgcagcgaggg
atccgcgatccccgggtgctggaggcaatgcgcaaggtgccgcgccaccttttcgttccc
ccggagctgcgggagcgcgcctacagggattgcccgctgcccattggctacggccagacg
atttctcagccctatattgtcgcctttatgactgaggcggcccgcctcacccctgagtcg
gtggtgctggaaatcggcaccggatccggctatcaggcggccattttggccgagctggcc
cggcaagtatatagcctggagcggctggctcccttggccgcccgcgctcagcaaaccctg
gcctccttgggctaccgcaacgtggaggtgcgccagggagatggctatcagggttggccg
gaacacgccccctacgacgccatcgtggtgacggcagcccccccaaccctgccgacgctg
ctgctggatcaactggcggtgggaggtaccctggtggtgccggtgggcgaaagccaggga
ttccaatccttgctgatcctccacaaaaccccggagggggtggtgcaaaagggggccttc
ccagtgcaatttgtgcccatggtttag

DBGET integrated database retrieval system