KEGG   Synechococcus sp. JA-3-3Ab: CYA_0992Help
Entry
CYA_0992          CDS       T00318                                 

Definition
iron-containing alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
cya  Synechococcus sp. JA-3-3Ab
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cya00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    CYA_0992
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CYA_0992
  Lipid metabolism
   00071 Fatty acid degradation
    CYA_0992
  Amino acid metabolism
   00350 Tyrosine metabolism
    CYA_0992
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CYA_0992
   00626 Naphthalene degradation
    CYA_0992
Enzymes [BR:cya01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     CYA_0992
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1005261..1006382)
Genome map
AA seq 373 aa AA seqDB search
MLRTCEFDLAIPAPGRLYRGSSILEAVPLTALGSRVLVIGGERSLAVAELPLKRNLGRDP
AVQVYWSTYGVDCSESELARLQALATAESVTGIVGVGGGKALDTAKLVAHRLGIPVATVP
TSAATCAAWSALSNIYSDTGAFQRDVALDRAPAALILDYELILQAPARTLVAGIGDALAK
WYESSVSSGASEDALVIGAVQQARVLRDLLLQQSVAALREPGGTAWKQVVDACICLAGIV
GGMGGAKCRTVAAHAVHNGLTHLPGHRATLHGEKVAFGILAQLRLEEILQGSQLALAART
QLLAFYRQVGLPLNLRDLHLDHLGSAELLQAAQVACQPGSDIHHLPFPVSPEALLVALTT
TDLTSSSPALLRL
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgctgagaacttgtgaattcgacctggccattccggccccaggccggctataccgcggc
agcagcatcctcgaggctgtccccctgacagctctgggatcccgcgtgttggtgatcggg
ggggagcgctccctggccgtggccgagctgcccctgaagcgcaatctggggcgggatccc
gccgttcaggtttactggagcacctatggtgtcgactgcagcgagtcggagctggctcgc
ctacaggccctggccacggcagagtccgtaaccggcattgtaggggtggggggcggcaag
gccctagacacggccaagttggtggcccatcgcttggggatcccggtggcgacggtgccc
acctccgccgccacctgtgccgcctggagcgccctgtccaacatctactctgacacaggt
gcctttcagcgggatgtggctttggatcgggcacctgccgctttgattctggactatgag
ctcatcctgcaggccccggcgcgcaccctggtggccgggattggagatgccttggccaag
tggtacgagtcttctgtcagcagcggcgcctcggaagatgccctggtgatcggagctgtg
cagcaggcccgcgttttgcgggatttgctcttgcaacaatcggtggcggccctgcgggag
ccgggtggcacggcttggaagcaggtggtggatgcctgcatttgcctggcggggatcgtc
ggcggcatgggaggggctaagtgtcgcaccgtggccgcccacgccgttcacaacggccta
acccatttgccgggacaccgggccaccctgcacggggagaaagtggcctttggcattttg
gcccagctccgcctagaggagatcctgcagggaagccagttggcgctggccgcccgcacc
cagttgctggcgttctaccgccaggtggggctgcccctcaacttgcgggatctccacctc
gaccacctgggatccgccgagctgctgcaagcagcccaggtggcctgccagccaggctcc
gatatccaccacctgcccttccccgtcagcccggaagccctgctggtggctcttaccacc
accgacctgaccagctccagccccgccttgctgcggctttag

DBGET integrated database retrieval system