KEGG   Synechococcus sp. JA-3-3Ab: CYA_1101Help
Entry
CYA_1101          CDS       T00318                                 

Gene name
hemG
Definition
protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
cya  Synechococcus sp. JA-3-3Ab
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:cya00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1126034..1127491
Genome map
AA seq 485 aa AA seqDB search
MNPATPEPLNAEVVVIGAGISGLTLAWRLQQGLSARGGSPQAVLLAEASSRVGGCISTQS
KDGYRWEEGPNSFTPTPALLNLIAEVGLTDQLVLADAKLPRYIYWEGALLPVPLSPAAAL
GSRLLSVGGKLRALQGLLGFVPPPPGHEETVRQFFRRQLGSEVAERLVEPFTSGVYAGDP
DQLSAVAAFPRVAGLEERYGSLFAGALQALRQRPQPSPAAIQPPPKRGQLGNLRQGLQQL
PEALAQKLGDSLRLGWRALQLKRAGELYWVGFETPEGSRWVAARQVVLALPAYEAAALLQ
ELNPPASQLLAEILYPPVAVVALAYPQEALPQPLRGFGHLIPRSQGLRTLGTIWASCLFP
ERAPQGYHSFLSFLGGATDAALARRRGIPPIPALSPEERAQIAHAELSQVLLTRRAEPVY
LGERLWPRAIPQYTLGHRQRIAQVQAHLASQTPGIWVCANYLDGVALGDCVRRAEALAQQ
LLSQV
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
gtgaatcctgcaactcctgaaccccttaacgcggaggtggtggtcattggggcgggcatc
agcggcctgacgctggcctggcgcctgcagcagggtttatcggctagggggggatcccct
caagcggtgctcctggcggaggccagctcccgcgtcggcggctgcatttccacccagtcc
aaagacggctaccgctgggaggaaggccccaatagctttacccccacccctgccctgctc
aacctcattgctgaggtgggcctgaccgaccaactggtgctggccgatgccaagctgccc
cgctacatctactgggaaggagcgctgttgccggtgcctctgagccccgcggcagccctg
ggatcacggctgctcagcgtgggcggcaagctgcgggctctgcagggcctgctggggttt
gtcccgccgccgccagggcacgaggaaaccgtgcggcagtttttccggcgacaactggga
tccgaagtggccgagcgcctggtggagccctttacctcgggggtttatgcgggggatccg
gatcagctcagcgccgtggcggctttccctcgcgtggcgggcctggaggagcgctatggc
agcctctttgccggcgccctgcaggctctgcgccaaagaccccagccttctcctgcggcc
atccaacccccgcccaaacggggccaactgggcaatctgaggcaggggctgcagcagttg
ccagaggccctagcccaaaagctgggcgacagcctgcggctgggttggcgagcgctgcag
ctgaagcgggcgggagagctctactgggtgggctttgagaccccagagggatcccgctgg
gtggctgcccgccaggtggtgctggccctccccgcctacgaggctgccgcgctgctacag
gagctcaaccccccggccagccagctcttggccgagatcctctatccgccggtggcggtg
gtggctctggcctatccccaagaggccctgccccagccgctgcggggctttggccacctc
atcccccgttcccagggcctgcgcaccctgggcacgatctgggcctcctgcctttttcca
gagcgggctccccagggctaccacagcttcctcagcttcctgggcggcgccaccgatgcg
gccttggcccgccggcgggggatcccgcccatccctgcgctgtctcctgaggagcgagcg
caaattgcccacgccgagcttagccaggttctgctcacccgccgcgccgagcccgtctac
ctgggcgaacgtctctggccccgcgccatcccccagtacacccttggccaccggcaacgc
atagcccaggtgcaggcccacctggcctcccagacgccagggatctgggtatgcgccaac
tacctcgatggcgtggccctgggcgattgcgtgcggcgggccgaggcgctggcgcagcag
ctgttgtcccaggtctag

DBGET integrated database retrieval system