KEGG   Synechococcus sp. JA-3-3Ab: CYA_1290Help
Entry
CYA_1290          CDS       T00318                                 

Gene name
trpA-2
Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cya  Synechococcus sp. JA-3-3Ab
Pathway
cya00260  Glycine, serine and threonine metabolism
cya00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cya01100  Metabolic pathways
cya01110  Biosynthesis of secondary metabolites
cya01130  Biosynthesis of antibiotics
cya01230  Biosynthesis of amino acids
Module
cya_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cya00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CYA_1290 (trpA-2)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CYA_1290 (trpA-2)
Enzymes [BR:cya01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CYA_1290 (trpA-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB ThiG FMN_dh NanE TMP-TENI
Motif
Other DBs
NCBI-ProteinID: ABC99470
CyanoBase: CYA_1290
CYORF: CYA_1290
UniProt: Q2JUY2
Position
1299385..1300230
Genome map
AA seq 281 aa AA seqDB search
MPTRITACFQALRSRGEKALIPYLTAGDPNLETTFEALQVLDQSGADLIELGVPYSDPLA
DGPVIQAAATRALSRGVTLGAILQGLRCLSLQAPLILFTYYNPIHQLGIPNFLHQLRQAG
CAGLVVPDLPLEEAGSLRQAAQAEEIDLILLVAPTSPPERMRRIAQQSSGFVYLVSTTGV
TGERATLEKRIPALLQQLRQQTPLPIGVGFGISTPDQARQIALWGADAAIVGSAFVQRLA
KAPTPEEGLQQIAHFCRALKAALQEVTTPECYSLLRTQGVQ
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgcccactcggatcacagcctgctttcaggcgctgcgcagccgtggtgaaaaagccctc
atcccctacctcaccgccggggatcccaacctggagacgaccttcgaggctttgcaggtt
ctggatcagagtggcgccgatctcatcgagctgggggtaccctactcggatcccttggcg
gatgggccggtgatccaagcagcagccacccgcgccctcagtcggggagtcactttgggc
gccattctacaaggcttgcgctgtctctcgctgcaggcccccctgatcctgttcacctac
tacaaccccatccaccagctcggcatccccaactttctgcatcaactgcggcaggccggc
tgtgccggcttggtcgtccccgatctgcctctggaagaggcgggatccctgcgacaagca
gcccaggccgaagagatcgacctcatcctgctggtggcccccaccagccccccggagcgc
atgcgccgcattgcccagcagtccagtggctttgtctacttggtcagcaccaccggcgtt
accggcgaacgggccaccctggaaaagcggatcccggctttgctgcagcaactgcgccaa
caaacccccctgccgattggggtgggcttcggcatctccactcccgaccaggcccgccag
atcgctctctggggagcagatgcggcgattgtgggcagcgcatttgtgcaacggctggcc
aaagcccccacgcctgaagaaggactgcaacaaatagctcacttttgtcgagccctcaaa
gcggccctgcaagaggtgaccactccagagtgttacagcctgttaaggactcaaggggta
caatag

DBGET integrated database retrieval system