KEGG   Synechococcus sp. JA-3-3Ab: CYA_1293Help
Entry
CYA_1293          CDS       T00318                                 

Definition
type III restriction-modification system, res subunit
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
cya  Synechococcus sp. JA-3-3Ab
Brite
Enzymes [BR:cya01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     CYA_1293
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1301518..1304331
Genome map
AA seq 937 aa AA seqDB search
MARTTIDRLIINSPYEEPKKHWRYDRETRTFELVEGQRPAGYVVATPGSKSFDDPGIFVE
IPLVNQIRLRVKAWREAGYPGITSITRRLLAHWHDPEEFDRRRFFFCQLEAVETLIWLTE
APAAERVGIEIPGDGGDFDRRCCKMATGTGKTIVMAMVIAWHILNKVANPQDARFSKNVL
VVAPGLTVKKRLAVLEPAGAGNYYEAFDIVPSTLLDKLRQGRVLVRNWHALAWESEEQIK
KRKSVDKRGAKSDEAYTREVLGEMANAHNLLVINDEAHHAWRVNWEAEGKYLRQRDLKDS
AQEATVWVGGLDRLHRSRGILTCYDFSATPFAPSGKKSSEEALFGWIVSDFGLNDAIESG
LVKTPRVVVRDDAVPNAKTYKSRLYHIYNDPEVKDDLNRRANPEELLPDLVLNAYYLLGY
DWRETWKAWKAADLPTPPVMITVCNRTETAARVKHAFESRRIPIDELCNSEGILHIDSKV
LEEAEAKEEFTAVVEASDEADDGEEEDVPVECRLTKAEQAERLRKIVDTVGQVGQPGEKI
QNVISVGMLSEGWDAKTVTHIMGLRAFTSQLLCEQVVGRGLRRTSYEINPQTGLLEPEYV
NIFGVPFTFLPHEDSGDGPPPPPTPKTAVEPDPAKAEFEIRWPNVVRIERLLQPTLTLDW
SKVQPLELDAAQTPQVAELAPILEGKPDVNQISRIELEKLAREFRTQRIIFETARNVFDQ
VRQSWRGSREILLAQLVRIVEQFIRSDRILISPPLFYQDELRRRLIITLNLSRVVQHVCE
AVRQENTEKLVPVFDRDHPIRSTGQMRTWYTSKPCERTRKSHINVCVYDSTWEASDAFVL
DNSSAVSAWAKNDHLGFEVLYLYRGVVRKYRPDFLVRLANGDMLILETKGQDTELDRVKR
RYLDEWVQAVNAHGAFGRWRWKVARYPGEIRDTLLQS
NT seq 2814 nt NT seq  +upstreamnt  +downstreamnt
atggcccggactaccattgaccgcttgatcatcaactctccctacgaggagccgaagaag
cactggcgctacgatcgcgagacgcgtacgttcgaactggttgaagggcagcggccagcg
ggttacgtggtagcgactcccggttccaaatctttcgacgatccgggcatcttcgttgaa
atcccgcttgtcaaccagatccgcctgcgcgtcaaagcctggcgcgaggcaggctatccc
gggatcaccagcatcaccaggcggctcttggcgcactggcatgacccggaggagttcgac
agacgtcgctttttcttctgtcaattggaagccgtcgagacgctcatttggctgaccgag
gcgcctgctgccgagcgggtgggcattgagatcccgggagacggcggggactttgatcgg
cggtgctgcaagatggccaccggcacgggcaagaccatcgtcatggcgatggtgattgcc
tggcacatccttaacaaagtggccaacccccaagatgcccgcttttcgaagaacgtgctg
gtcgttgcccccggtctgacggtcaagaaacggctggcggtgctggagcccgcgggcgcc
ggtaactattacgaagcgttcgacattgtgccgtccacgctgctcgacaagctgcggcag
gggcgggtgctggtccgcaactggcatgccctggcctgggagagcgaagagcagatcaaa
aagcggaagagcgtggacaaacgcggcgcgaagagcgatgaagcctatacgcgcgaggtg
ctgggcgagatggccaacgcgcacaacctgctggtcatcaacgacgaggcgcaccacgcc
tggcgcgtcaactgggaagccgaaggcaagtacctgcgccagcgtgatttaaaagacagc
gcccaagaagcgacggtgtgggttggaggcctggatcggctgcaccgttcgcgcggcatt
ctcacctgttacgacttctccgccacccccttcgcgccctcgggaaagaagagcagtgaa
gaggcgctctttggctggatcgtcagcgacttcgggctgaacgacgccatcgaatcgggg
ctggtcaagaccccgcgcgttgtagtgcgtgacgacgctgtgcccaatgccaaaacctac
aagtcccgtctataccacatctacaacgacccggaggtgaaagacgacctcaaccgacgc
gccaatcccgaagagctgctgccggatctggtgctgaacgcctactacctgctgggctac
gactggcgggagacgtggaaggcctggaaagcagccgacctgcccacgccgcctgtgatg
atcactgtctgtaaccgcactgagacggcagcgcgggtcaagcacgccttcgaatcacgg
cgcattcccattgacgagctgtgtaactcggagggaatcttgcacatcgactcgaaggtg
ctagaagaggctgaggcaaaggaagagttcactgcagtggtggaagcttcagacgaggcc
gatgatggagaagaggaggacgtaccggtcgaatgccggctgaccaaagcagagcaggcg
gaacgtttgcgaaagatcgtagatacggtgggccaggtggggcagcccggcgagaaaatc
cagaacgtcatttccgttgggatgctcagtgagggctgggatgccaagacggtgacgcac
attatggggctgcgggccttcacttcccaacttctgtgcgagcaggtcgtgggccggggc
ctgcgccgcacatcctacgagatcaacccacaaacagggctgcttgagcccgaatacgtc
aatatcttcggcgtgccttttactttcttgccgcacgaggatagcggagatggcccgccg
cccccgccaacgcccaagaccgccgtagaaccggacccggccaaagcggagtttgagatc
cgctggccgaatgtggtgcgcatcgagcgcttacttcagccaacgttgactctcgattgg
tcaaaggtgcagccattggaactagacgcggctcagacgccgcaagtggcagaactggca
ccaattctcgaaggcaagcccgacgtaaaccagatcagccgtatcgaactggagaagttg
gcgcgagagtttcgcacgcagcgcatcatcttcgaaactgcccgcaatgtgttcgatcag
gtaaggcaaagctggagaggcagtcgcgaaatcttgctggcgcagttggtgcggattgtc
gagcagttcattcgctctgaccggattttgatctccccacctcttttttatcaggacgaa
ctgcgccgtcggctgatcatcaccctcaacctgtcacgagttgtgcaacatgtctgcgag
gcggtgcggcaggagaacactgagaaacttgtgccagtcttcgatcgcgaccacccgatc
cgctcgacgggccaaatgcgcacctggtacaccagcaaaccttgtgaacgcacgcgcaag
tcgcacatcaacgtctgcgtctacgacagcacgtgggaggcgtcggatgctttcgtattg
gacaatagcagtgccgtgagcgcctgggcgaagaacgaccatctgggcttcgaagtcctg
tacctgtatcgcggcgtggtgcggaagtatcggccagattttcttgtgcgcctggccaac
ggcgacatgctcattctggaaacaaagggacaggacaccgaactagaccgggtgaagcgg
cgctatctggacgagtgggtgcaagccgtcaatgcccatggcgcgttcggtcgctggcgg
tggaaggtggcacgttacccgggcgagatacgagacactttgctgcaaagctag

DBGET integrated database retrieval system