KEGG   Synechococcus sp. JA-3-3Ab: CYA_1871Help
Entry
CYA_1871          CDS       T00318                                 

Gene name
est
Definition
carboxylesterase (EC:3.1.1.1)
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
cya  Synechococcus sp. JA-3-3Ab
Brite
Enzymes [BR:cya01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     CYA_1871 (est)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1875186..1875968
Genome map
AA seq 260 aa AA seqDB search
MLSNEPFLWRGRGDHACLLLHGLGGGVYELQWLAERLLAAGLTVQGFNYPGHDRPAPRMP
PSRWTEWYGRVLEHYLALQQEYPRLSLVGFSTGCLLALHLAFAHPVHKLVLLAPFFAIRH
RWYYLFRPEQYLNSLGWLLEEVPRFRLPIRDGDVRALAERVAYLRSFNLTAVRSALELIE
RVRGEVASIQVPTLILQPRQDTVVDPDQAAWLYRELGSAEKTLHWLERSDHVLTLDCERE
TVFAQVCAFLNQDPSAPGSA
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgctgagcaacgagccttttctgtggcggggaagaggggatcatgcttgcctgctgctg
cacgggttggggggtggcgtctacgagttgcagtggctggcggagcggctgttggcagcc
ggcctgacggtgcaggggtttaactatcccggccacgaccgcccggcaccccgcatgccc
ccttcccgctggacggagtggtacgggcgggttttggaacattacctggcgctgcagcag
gagtacccgcgcctttcgctggtggggttttccaccggctgcctgttggcgctgcacctg
gcctttgcccaccctgtccacaaattggtcctgctggcgccgttttttgccattcgccac
cgctggtactatctctttcgcccggagcagtacctcaacagcctgggctggctcttggaa
gaggttccccgctttcgcctgccgattcgggatggcgatgtccgcgcgttggcagaaaga
gtggcctatttgcgcagcttcaatctaacggcggtgcgcagcgcccttgagctcatcgag
cgggtcaggggggaagtagccagcatccaagttcccaccctcatcctgcagccgcgccaa
gatacagtggtggatcccgaccaggcggcgtggctctaccgggagctgggatccgccgag
aagaccctgcattggctggagcgctccgaccacgttctcaccttggactgcgagcgggag
acggtgtttgcccaggtttgcgccttcctcaaccaggatccttctgcgcccggatcagcg
taa

DBGET integrated database retrieval system