KEGG   Synechococcus sp. JA-3-3Ab: CYA_1936Help
Entry
CYA_1936          CDS       T00318                                 

Gene name
chlI
Definition
magnesium chelatase, ATPase subunit I (EC:6.6.1.1)
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
cya  Synechococcus sp. JA-3-3Ab
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:cya00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1947458..1948516
Genome map
AA seq 352 aa AA seqDB search
MNLERRPVFPFTAIVGQEEMKLALLLNVIDPRIGGVLIMGDRGTGKSTTIRALADLLPQI
EVVKGDPFNSHPRQRDLMSDQVWERLQAGETLETTWIQVPMVDLPLGATEDRVCGTLDIE
RALSQGVKAFEPGLLAKANRGILYVDEVNLLDDHLVDVLLDAAASGWNTVEREGISIRHP
ARFVLVGSGNPEEGELRPQLLDRFGMFVRIETVRDPALRVQIVEERSQFDADPQAFLAKY
AEAQQRLRERIEKAQHLLPTVMVDPELRLKISGVCAALEVDGLRGDIVTNRAAKALAALE
GRSEVTVADIRRVISLCLRHRLRKDPLETIDSGYKVEKAFSEVFQVSLESAA
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgaacttggaacgtcgcccggttttcccgtttaccgccattgtcggccaggaggagatg
aagttggccctgctcctcaacgtcatcgatccccgcatcggcggggtgctaatcatgggg
gatcgcggcacgggcaagtccaccaccatccgcgccttggccgatctgctgccccagatc
gaggttgtcaagggggatccgttcaacagccacccgcggcagcgggatctgatgagcgac
caggtgtgggagcgcctgcaggcgggggaaaccctggaaaccacctggatccaggtgccg
atggtggatctgcccctgggagccacggaagaccgggtctgcggcactctcgacatcgag
cgcgccttgtctcagggggtgaaggcttttgagccggggctcttggccaaggccaaccgc
ggcatcctctacgtggacgaggtcaacctcctggacgaccacctggtggatgtcttgctg
gatgcggcggcctctggctggaacacggtggagcgggaagggatttccattcgccacccg
gcccgctttgtcctggtgggatccggcaaccctgaagagggagaattgcggccccaactc
ttggatcgcttcggcatgtttgtccgcatcgagacggtgcgggatccggccctgcgagtg
cagatcgtggaggagcgcagccagttcgacgccgacccccaggcttttctggccaaatac
gccgaggcccagcagcgcctgcgggagcgcattgaaaaggcccagcacctcttgccgact
gtgatggtggatcctgagttgcgcctgaagatctccggcgtgtgtgcggcgctggaggtg
gatgggctgcggggcgatatcgtcaccaaccgggcagccaaggcgttggcagctctggag
gggcgcagcgaggtcaccgttgccgatattcgccgggtcatcagcttgtgtttgcgccac
cgcctgcgcaaggatccgctggaaaccatcgactccggctacaaggtcgagaaggccttt
agcgaggtgtttcaggtgagcctggagagcgccgcttag

DBGET integrated database retrieval system