KEGG   Synechococcus sp. JA-3-3Ab: CYA_2134Help
Entry
CYA_2134          CDS       T00318                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
cya  Synechococcus sp. JA-3-3Ab
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cya00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CYA_2134 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CYA_2134 (glk)
   00052 Galactose metabolism
    CYA_2134 (glk)
   00500 Starch and sucrose metabolism
    CYA_2134 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    CYA_2134 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CYA_2134 (glk)
   00524 Butirosin and neomycin biosynthesis
    CYA_2134 (glk)
Enzymes [BR:cya01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     CYA_2134 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
2147594..2148640
Genome map
AA seq 348 aa AA seqDB search
MELLLAGDIGGTKTSLSLFNAQDPDHSLYHCRYASQSYPNLTPVVLEFLAQARQELGRDP
QPVAACFAVAGPVVEEKSSPGAGGQRAKITNLPWSLHSSQLAAELGIPRLALINDFSAVG
YGVLALRDQDLETLQTGERQPQAPIGVIGAGTGLGQAYLTWGEGGYQVHASEGGHVDFSP
RTPLEWELLRYLQQRHGRVSTERVVSGQGIVAIYQFLRDSRWGQGEEQLLAQIAAWERGA
SPVDPAAQIANAALEGRDPLAVECLRLFTSLYGAAVGNFALHLLPRGGLFIAGGIAPKLL
RLLREGEFLPSFLDKGRMRTLLEQLSVQVVVNAQVGLIGAAHYAATLL
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atggagttgctgttggcgggagatatcgggggcaccaagaccagcctcagcctcttcaat
gcccaagatcccgatcacagcctctaccactgccgctacgccagccagagctatcccaac
ctcaccccggtggtgctggagtttctggcccaggcacggcaggagctggggcgagatccc
caaccggttgccgcctgctttgctgtggccggccccgtagtggaagaaaaaagcagtcca
ggagccgggggacagagggccaaaatcaccaacctgccctggagcctgcactcaagccag
ttggcggcggagctggggatcccccgcctagcgttgatcaacgacttcagcgccgtaggc
tatggggtgctggccctgcgagatcaggatctggaaacgctgcagacaggagagcggcag
ccccaggcgcccatcggcgtcatcggggcgggcacagggctggggcaggcctacctcacc
tggggagaaggcggctaccaggttcatgccagcgagggggggcatgtggatttttctcca
cggacccctttggaatgggagctgctgcggtatctgcaacaacgacatgggcgcgtctcc
accgagcgggtggtctcggggcaggggatcgtggccatctatcaatttctgcgggatagc
cgctggggccagggagaggagcagttgctggcccaaattgccgcctgggaaaggggagcc
agccccgtcgacccagccgcccaaattgccaatgccgccctggagggacgggatcccttg
gcggtggagtgtttgcggctgtttaccagcttgtatggggccgctgtcggcaattttgcc
ctgcacctgctgccccgtgggggcctgttcatcgccggcgggatcgcgcccaagctcctg
cgcctgttgcgggagggagagtttttgccctcctttttggataagggacggatgcgcact
ctgctggagcaactgtcagtgcaggtggtggtgaacgcccaggtgggcttgataggggct
gcccactatgccgccactttgctgtag

DBGET integrated database retrieval system