KEGG   Synechococcus sp. JA-3-3Ab: CYA_2283Help
Entry
CYA_2283          CDS       T00318                                 

Gene name
cysQ
Definition
3'(2'),5'-bisphosphate nucleotidase (EC:3.1.3.7)
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
cya  Synechococcus sp. JA-3-3Ab
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:cya00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
CyanoBase: 
CYORF: 
UniProt: 
Position
2288683..2289480
Genome map
AA seq 265 aa AA seqDB search
MQDLADLLPHVSRLAETAGQAILEIYRQDQIRVRDKADSSPLTEADLAAHHLILRGLQDL
TPGLPVLSEESGGIPYPERQQWRQFWLVDPLDGTREFIGRSGQFTVNIALVEAGIPILGV
VHAPALGLTYRAVQRLGAYRGDQPIRARPPAQAPLQVVASRSHRGPETEQFLERLRRRYG
SLEVKSVGSALKLCLVAEGSAHLYPRFDPTMEWDTAAAHCIVEQAGGSVTDLKGDPLRYN
KPDLHNPPFVAAAADAAQLWQELVP
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgcaggatctggccgatctcctgccccatgtcagccgccttgcggaaacagccgggcag
gccattttggagatctatcggcaagatcagatccgggtcagggacaaggccgactcctcc
cccctcaccgaagccgatctggccgcccaccacttgatcctgcggggcctgcaagatctg
acccccggcctccccgtgctctcggaagaatccggcgggatcccgtatccggagcggcaa
cagtggcggcagttctggctggtggatcccttggacggcacgcgcgagtttatcgggcgc
agcggccagttcaccgtgaacatcgccctcgtcgaggcagggatccccatcttaggcgtc
gtccatgcccccgctctcggccttacctacagggctgtgcaaaggctgggggcctataga
ggagatcagcccatccgggcccgcccgcccgcccaggcccctctgcaagtggtggccagc
cgctcccaccgcggcccggagacggagcaatttctcgagcggctgcggcggcgctacggt
tccctcgaggtgaagtcggtgggcagcgccctgaaactctgccttgtggccgagggatcc
gcccatctctacccccgcttcgacccaaccatggagtgggatactgctgctgcccactgc
atcgtcgagcaagccgggggaagcgtcaccgatctaaaaggggatcccttgcgctacaac
aagcctgatctgcacaacccgccctttgtggcggctgccgccgatgcagcccaactgtgg
caggagctggttccctag

DBGET integrated database retrieval system