KEGG   Synechococcus sp. JA-3-3Ab: CYA_2349Help
Entry
CYA_2349          CDS       T00318                                 

Definition
fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
cya  Synechococcus sp. JA-3-3Ab
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cya00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    CYA_2349
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    CYA_2349
Enzymes [BR:cya01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     CYA_2349
Lipid biosynthesis proteins [BR:cya01004]
 Desaturase
  First
   CYA_2349
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
CyanoBase: 
CYORF: 
UniProt: 
Position
2357019..2357912
Genome map
AA seq 297 aa AA seqDB search
MAVSLPTQSLDNPNRFASLAQPEPQKSFRFAWEFVLFFVVFHALALVGGIVCFSWPALGV
ALLLHWCFGSLGICLGYHRLLSHRSFQVPKWLEYVFATFGALAIQGGPIFWVAGHRQHHA
FTEDEERDPYSARKGFWWSHMLWLIYQREEFFNREKYSAFAPDLARDPFYRWLDKYGLLL
QLPLAGVLYLLGGWPFVIYGIFVRTVLLLHCTWLINSASHFWGYRTFESDDNARNLWWAA
LLTYGEGWHNNHHADPKCVKAGLRWWEIDMTYWVIWVLARLGLARKLHLPAQSQPTR
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atggccgtttcccttcccacccaatcgctggacaatcccaaccgttttgcttcgctagct
cagcctgagccccaaaagtcttttcggtttgcctgggaatttgttctttttttcgttgtt
tttcacgccctcgctttagtgggcggcatcgtttgcttttcctggccagccttgggggtg
gccctattgcttcactggtgcttcggcagcttgggcatctgcctggggtatcatcgtctg
cttagccatcgcagcttccaagtgcccaagtggctggaatatgtctttgctaccttcggt
gctctcgccatccagggggggccgatcttttgggtggccggccatcgtcagcatcacgct
tttactgaagacgaagagcgggatccctactctgctcgcaagggcttttggtggagccac
atgctctggctcatttaccaacgggaagagttttttaaccgtgagaagtattctgccttt
gcgccggatttggctcgggatcctttttatcgctggctagacaagtatgggctgctgctg
caactgccgctggctggagtgctttacctgctcggcggttggccgttcgttatctacggc
atcttcgtgcggacagtgctgctgctgcactgcacctggttgatcaactctgccagccac
ttctggggctaccggactttcgagagcgacgacaatgcccgtaacctttggtgggcggct
ctcctcacctacggtgaaggctggcacaacaaccatcacgccgacccgaagtgcgtgaaa
gcaggtttgcgctggtgggaaattgacatgacctactgggtcatttgggtgttggcaaga
ctgggtttggctcgtaagttgcacttgcctgctcaaagtcagccaactcgctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system