KEGG   Synechococcus sp. JA-3-3Ab: CYA_2369Help
Entry
CYA_2369          CDS       T00318                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
cya  Synechococcus sp. JA-3-3Ab
Pathway
cya00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cya01100  Metabolic pathways
cya01110  Biosynthesis of secondary metabolites
cya01130  Biosynthesis of antibiotics
cya01230  Biosynthesis of amino acids
Module
cya_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cya00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CYA_2369 (trpC)
Enzymes [BR:cya01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     CYA_2369 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS ThiG His_biosynth NanE
Motif
Other DBs
NCBI-ProteinID: ABD00495
CyanoBase: CYA_2369
CYORF: CYA_2369
UniProt: Q2JS87
Position
2379498..2380418
Genome map
AA seq 306 aa AA seqDB search
MELEGELLAVRRRSPAPPVVVASQVYRTKAPEAEPRHILEEIVWHKEQEVERQREQLPLK
QLQQQLEQAPPVRDFVAALTQSPHPVSLIAEVKKASPSRGVLRDPFDPVAIAQSYEAAGA
SCLSVLTDERFFQGSGEYLRQIRQAVGIPILCKEFILYPYQILWARTLGADAVLLIAAIL
SDADLGYFLKLIQQLGMAALLEVHTCQELQRVLALPHLQQAKGRVLIGINNRDLKTFAVD
LNTTRDLLVAHRERLGDLPVVSESGIHTPADLQQLRSWGVRAVLVGEALVTQPDPGQAVR
SLLSSQ
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggagctggaaggtgagctgcttgccgttcgtcggcgttctcctgccccgccggtggtg
gtggcctcgcaggtgtaccggacaaaggctccagaggccgagccacgccacattttggag
gagatcgtctggcacaaagagcaggaggtggagcgccaacgggaacagcttcctctgaag
caattgcagcagcaactggagcaagcgccaccggtgcgggattttgtggcggccctcacc
caatcccctcaccccgtttcccttatcgctgaggtgaaaaaagcttcccccagccgtggg
gttctccgcgatccctttgatccggtggccattgcccaaagctacgaggcggcgggagcc
agttgcctgtcggtgctcacggatgagcggttttttcagggcagcggcgagtacttgcgc
cagatccgccaggcggtagggatccccatcttgtgcaaggagttcatcctctacccttac
caaatcctctgggcccgcactctgggagcggatgcggtgctgttgattgccgccattctc
tcggatgcggacttgggctattttctcaagctcattcagcaactgggcatggcggctctg
ttggaggtgcacacttgccaagagttgcagcgggttttggccttgccgcacctgcaacag
gccaaaggacgggtgctgatcggcatcaacaatcgggatctcaaaacctttgcggtggac
ttgaacacgacgcgggatctcttggtcgcccatcgggagcgcctcggcgatctgccggtg
gtcagcgagtctggcatccacacccctgctgacttgcagcagttgcgcagttggggggtg
cgcgctgtgctggtgggggaagcgctggtaacgcagccggatcccggccaagccgtccgc
tccctgttgtcatcccagtaa

DBGET integrated database retrieval system