KEGG   Synechococcus sp. JA-3-3Ab: CYA_2369Help
Entry
CYA_2369          CDS       T00318                                 

Gene name
trpC
Definition
indole-3-glycerol-phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
cya  Synechococcus sp. JA-3-3Ab
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cya01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:cya00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
CyanoBase: 
CYORF: 
UniProt: 
Position
2379498..2380418
Genome map
AA seq 306 aa AA seqDB search
MELEGELLAVRRRSPAPPVVVASQVYRTKAPEAEPRHILEEIVWHKEQEVERQREQLPLK
QLQQQLEQAPPVRDFVAALTQSPHPVSLIAEVKKASPSRGVLRDPFDPVAIAQSYEAAGA
SCLSVLTDERFFQGSGEYLRQIRQAVGIPILCKEFILYPYQILWARTLGADAVLLIAAIL
SDADLGYFLKLIQQLGMAALLEVHTCQELQRVLALPHLQQAKGRVLIGINNRDLKTFAVD
LNTTRDLLVAHRERLGDLPVVSESGIHTPADLQQLRSWGVRAVLVGEALVTQPDPGQAVR
SLLSSQ
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggagctggaaggtgagctgcttgccgttcgtcggcgttctcctgccccgccggtggtg
gtggcctcgcaggtgtaccggacaaaggctccagaggccgagccacgccacattttggag
gagatcgtctggcacaaagagcaggaggtggagcgccaacgggaacagcttcctctgaag
caattgcagcagcaactggagcaagcgccaccggtgcgggattttgtggcggccctcacc
caatcccctcaccccgtttcccttatcgctgaggtgaaaaaagcttcccccagccgtggg
gttctccgcgatccctttgatccggtggccattgcccaaagctacgaggcggcgggagcc
agttgcctgtcggtgctcacggatgagcggttttttcagggcagcggcgagtacttgcgc
cagatccgccaggcggtagggatccccatcttgtgcaaggagttcatcctctacccttac
caaatcctctgggcccgcactctgggagcggatgcggtgctgttgattgccgccattctc
tcggatgcggacttgggctattttctcaagctcattcagcaactgggcatggcggctctg
ttggaggtgcacacttgccaagagttgcagcgggttttggccttgccgcacctgcaacag
gccaaaggacgggtgctgatcggcatcaacaatcgggatctcaaaacctttgcggtggac
ttgaacacgacgcgggatctcttggtcgcccatcgggagcgcctcggcgatctgccggtg
gtcagcgagtctggcatccacacccctgctgacttgcagcagttgcgcagttggggggtg
cgcgctgtgctggtgggggaagcgctggtaacgcagccggatcccggccaagccgtccgc
tccctgttgtcatcccagtaa

DBGET integrated database retrieval system