KEGG   Synechococcus sp. JA-3-3Ab: CYA_2427Help
Entry
CYA_2427          CDS       T00318                                 

Gene name
psbJ
Definition
(GenBank) photosystem II reaction center protein PsbJ
  KO
K02711  
photosystem II PsbJ protein
Organism
cya  Synechococcus sp. JA-3-3Ab
Pathway
Photosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cya00001]
 Metabolism
  Energy metabolism
   00195 Photosynthesis
    CYA_2427 (psbJ)
Photosynthesis proteins [BR:cya00194]
 Photosystem and electron transport system
  Photosystem II (P680 chlorophyll a) [OT]
   Other common subunits
    CYA_2427 (psbJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(2436836..2436955)
Genome map
AA seq 39 aa AA seqDB search
MTSQARIPLWIVAVVVGLGVVTVVGLFFYGSYTGLGAPV
NT seq 120 nt NT seq  +upstreamnt  +downstreamnt
atgactagtcaggcaaggatccctctgtggatagtggctgtggttgtcggtttgggtgtg
gtcacggtggttgggcttttcttctatggctcctataccggtcttggagcgcccgtgtag

DBGET integrated database retrieval system