KEGG   Synechococcus sp. JA-3-3Ab: CYA_2436Help
Entry
CYA_2436          CDS       T00318                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
cya  Synechococcus sp. JA-3-3Ab
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cya00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CYA_2436 (malQ)
Enzymes [BR:cya01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     CYA_2436 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(2447528..2449129)
Genome map
AA seq 533 aa AA seqDB search
MRMGRLSGILLHPTSLPGPFGIGDLGPAAYRFVDFLVESGQRLWQVLPLGPTGWGNSPYM
SFSAIAGNPLLISPELLVKAGWLEPNGWQDLPQWPAIQAGNAERVDYETVIPFKLGLLHR
AWATFKEKASAADWEAFQAYCAAEADWLPDYALFMALKEVYGDQEWTQWDPALAQRDPLA
LQEARDRHADAITRQMFWQYLFAQQWGSLREYAHRHQVQLIGDIPIYVAPNSADVWANRE
LFHLDEQGRPLQVAGVPPDYFSPTGQRWGNPLYNWEVLKARGYDWWIRRIQAILKQVDCV
RIDHFRGFESYWAIPGAAETAVEGEWQKGPGADFFQALADKLGKIPVIAEDLGDITPEVL
QLRDQFGLPGMKVLLFAFGSGPDNPYLPHSYERNFVVYTGTHDNNTVVGWFHDPERPEWE
KQNLLRYLGCQGSDGIHWDLIRLALASVADLAIIPLQDVMGLGAEARMNFPGRAENNWAW
RYREEMLRPELAQRLAELSVTYGRISPQELEQRRAALAQERAAGSSQAAPGLV
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatgggcagactcagtggcatcctcttgcaccccacctcgctaccggggccattt
ggcatcggcgatctggggccggctgcctaccggtttgtggattttctggtggaaagcggc
cagcgcctctggcaggtgctgccccttggccccaccggctggggcaactccccctacatg
agcttttctgccattgccggcaacccactgctgattagcccggagctgctggtgaaagcc
ggctggctggaacccaacggctggcaggatctgccccaatggccagccatccaggcgggg
aatgctgagcgggtggactacgaaaccgtgatccccttcaagctgggcctgctgcaccgc
gcctgggctaccttcaaagaaaaagcgtccgccgccgactgggaagctttccaagcctac
tgtgctgccgaggccgattggctgccggactacgccctgttcatggccctcaaagaggtg
tatggcgaccaggaatggacccaatgggatccagccttggcacaacgggatcccctggct
ttgcaagaggcccgtgaccgccatgccgatgccatcacccggcagatgttttggcagtat
ctatttgcccaacagtggggatccctaagagagtacgcccaccggcatcaagtgcagctc
atcggggacatacccatctatgtcgcccccaacagcgccgatgtgtgggccaaccgggag
ctgtttcacctggatgaacaaggacggcccttgcaggtagccggcgtgccccccgactat
ttcagccccaccgggcagcgctggggcaaccccctctacaactgggaggtgctcaaggcc
cgcggctacgactggtggatccggcgcatccaggccattctcaagcaggtggattgcgtc
cgcatcgaccacttccgcggcttcgagagctactgggccatccccggcgctgcggaaaca
gcggtagaaggcgagtggcaaaaagggccgggggccgacttctttcaggcgctggccgac
aagctggggaaaatcccggtgatcgccgaagatctgggagacattacgccggaggtgttg
caactgcgggatcaatttggcctgcccggcatgaaggtgctgctctttgcctttggctcg
gggcccgataacccctatctgcctcacagctacgagcgcaacttcgtcgtctacaccggc
acccacgacaacaacaccgtggtgggctggtttcatgacccagaacgcccggagtgggaa
aagcaaaacctgttgcgctacctgggctgccagggatccgacggcatccactgggatctg
attcgcctggccctggcttccgtggccgacctggccatcattcccctgcaagatgtgatg
ggcctgggggcagaggcgcgcatgaacttccccggcagggccgagaacaactgggcctgg
cgctaccgcgaggagatgctgcggccggagctggcccagcggctggcggagctgagcgtc
acctacgggcgcatctctccgcaagagttggagcaacggcgggcagccctggcccaagaa
cgagcggcaggatcttctcaagctgcccccggcctcgtctaa

DBGET integrated database retrieval system