KEGG   Synechococcus sp. JA-2-3B'a(2-13): CYB_0056Help
Entry
CYB_0056          CDS       T00319                                 

Gene name
gmk
Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
cyb  Synechococcus sp. JA-2-3B'a(2-13)
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:cyb00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    CYB_0056 (gmk)
Enzymes [BR:cyb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     CYB_0056 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
68551..69216
Genome map
AA seq 221 aa AA seqDB search
MRRSLSMPTSPTPVSSECTQQQGSLPAPTPRGRLVVLTGPSGVGKGTLVNQLRQRHPELY
LSVSVTTRPPRPSEQEGVNYYFRSREEFLNLIEANELLEWAQYAGNFYGTPREIVFQKLN
QGQDVLLEIELAGARQVRQQYPDAIRIFLCPPSLEELERRIRERGQDSEASIERRLEQAR
KELDAQDEFDYVIVNDNLEQALQELEALLYPPSPSSKEQQP
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
ttgcgtcggtctctgtctatgccaacctctcctaccccggtttcctctgagtgtacgcag
cagcagggatcccttccggctcctaccccgcgcggtcgcttggtggttttgacagggccc
agcggagtgggtaagggtacgctggtcaaccagttgcgccagcgccaccccgagctgtat
ctctcggtttcggtcaccacccgccccccccgccccagcgaacaggaaggtgtcaactac
tactttcgcagccgggaggaatttctcaacttgattgaagccaacgagctgttggaatgg
gcacagtatgcgggcaacttttacggcactccccgcgagatcgtgttccaaaaacttaac
cagggtcaggatgtgctgctggaaattgagctggcgggggcccgtcaggtgaggcagcag
tacccagatgccattcgcatctttctttgtcccccttctctggaagagctggaacgtcgc
atccgcgagcgcggacaagactcagaggccagcatcgagcgccgcctggagcaggcccgc
aaggaattggatgcccaagacgaatttgactacgtgattgtcaacgacaacctggagcaa
gcgctgcaggagctggaagccctgctctatcccccctctccctcttcaaaggagcagcag
ccctag

DBGET integrated database retrieval system