KEGG   Synechococcus sp. JA-2-3B'a(2-13): CYB_0073Help
Entry
CYB_0073          CDS       T00319                                 

Gene name
hisD
Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
cyb  Synechococcus sp. JA-2-3B'a(2-13)
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cyb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CYB_0073 (hisD)
  Amino acid metabolism
   00340 Histidine metabolism
    CYB_0073 (hisD)
Enzymes [BR:cyb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     CYB_0073 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
84796..86109
Genome map
AA seq 437 aa AA seqDB search
MLRIVTQLAEAEAELRRISERTQADQNLHREATVREILQAVRRQGDRALLTYTAEFDQVE
LSVAELKVSGAELEAAYQAVSPQLLSALRLAKQRIEAFHRQRVPSSWVSFPGPEIVLGKQ
YRPVDRAGLYIPGGRAAYPSTVLMNAIPAQVAGVPEIVMVTPPGSDGLGGKGISPAILVA
AQEVGIHTIYRVGGAQAIGALAYGTETIPKVDVITGPGNIYVTLAKKLVYGTVGIDSLAG
PSEVLIIADESANPLYVAADLLAQAEHDPLAAAILLTTDLQLAQQVQQAVATQMEAHPNR
LMVEKSVVNYGLIAVVPDLTAAVALSNLFAPEHLELQVADPWALLDPIRHAGAIFLGHHT
PEAVGDYLAGPNHTLPTAGAARYASALGVETFLKHSSLIQYSSAALREVASAIQALTQAE
GLPAHGQSVQVRLAEER
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgctgagaatcgtcacccagctagccgaggctgaagccgagctcagacggatctcggag
cgcactcaggctgaccagaacctgcaccgcgaagcaactgtgcgggagatcctgcaagcg
gtacgccgtcagggggatcgggccctgctgacctatacggctgagttcgaccaggtggag
ctgagcgttgccgagctgaaggtgtctggggccgagctagaggcagcttaccaggcggta
tctccgcaattgctttcagccctacggctggccaagcagcgcattgaagcttttcaccgg
cagcgggtgcccagcagttgggtaagctttcccggccctgagatcgtcttgggcaagcaa
taccgccctgtggatcgcgccggcctctacattccgggagggcgagccgcctatcccagc
acggtgttgatgaacgccatcccggcccaggtggcaggggtgcccgagattgtgatggtg
acgccaccgggatctgacgggttggggggcaaggggattagcccggccattttggtggcc
gcccaagaagtaggcatccacaccatctatcgcgttgggggggctcaggcaataggggct
ttggcctacggcaccgagaccatccccaaggtggacgtgatcaccggccccggcaacatc
tacgtaactttggccaaaaagctggtgtacggcacggtggggatcgactcgctggccggg
ccatcggaggtgttgatcatcgccgacgagagcgccaaccccctttatgtggctgccgat
ttgctggcccaagccgagcacgatcccttggcggcggccatccttctgaccaccgatctc
cagctggcccagcaggtgcagcaggcggtggccacccagatggaggcccatcccaaccgt
ctgatggtggaaaagtcggtggtgaattacgggctgattgcggtggtgccggatctgacg
gcggcggtggctttgtccaacctgtttgcgccagagcatttggaactgcaggtggcagat
ccctgggctttgctggatcccattcgccatgcgggggccattttcttgggccaccatact
ccggaggcggtaggagattacctggccggccccaaccataccttgcccaccgccggtgcg
gcccgctatgcctcggctttgggggtggaaactttcctaaagcattccagtctgattcaa
tacagctcagcggctttgcgggaggtggccagcgccattcaggctctcacacaagcggaa
gggttgcccgcccacggccagtcggtacaggtgcggttggcggaggagcgctaa

DBGET integrated database retrieval system