KEGG   Synechococcus sp. JA-2-3B'a(2-13): CYB_0095Help
Entry
CYB_0095          CDS       T00319                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
cyb  Synechococcus sp. JA-2-3B'a(2-13)
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cyb00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CYB_0095 (murA)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CYB_0095 (murA)
Enzymes [BR:cyb01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     CYB_0095 (murA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
CyanoBase: 
CYORF: 
UniProt: 
Position
110944..112338
Genome map
AA seq 464 aa AA seqDB search
MKGFDNRVSGADPLEPGLTPPQTGMATAPEMMGPVLKIIGKQTLSGHIPIGGAKNSALAL
MAGAILAPEACRIHNVPRLLDIERMGQILATLGVKVSHVGNTLDLDASSLKTSQAPYELV
SQLRASFFIIGPLLARLGVARVPLPGGCAIGSRPVDLHVRGLQALGATVQIEHGVVHAYA
RKLLGTRIYLDYPSVGATETLMMAATLADGETVIENAAQEPEVADLARFCQAMGARIRGV
GTNTVVVVGVPRLHGTEYTVIPDRIEASTYLIAGAITRSHLTVGPVIPDHLRAVIAKLQA
MGLRVEEEGPNRLRIAPAQLSSGWLCQATDIQTLPYPGFPTDVQAPIMALAALSEGSCTI
EETVFENRMHHIPELNRMGADIRLKNRVALIRGVPSLSGAPVVATDLRAGAALVLAGLAA
EGCSTIHGLHYIDRGYEAIDEKLRSVGAKVYRSESPTGIPQLGK
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaggttttgacaatcgcgtcagcggggcggatcccctagagcctggcctgacgccg
ccccagaccggcatggcaaccgcgccagagatgatggggccagtgctgaaaatcattggc
aagcagaccctgagtggccacatccctattggcggggcaaaaaactctgccttggcgctg
atggccggggccatcttggctcctgaggcctgtcgaattcacaacgtgccgcgtctgctg
gacattgaacgcatggggcagatcctggccacgctgggagttaaggtttcccatgttggc
aataccctggacctggatgccagctccctcaaaacctctcaagccccttatgaattggtc
agccagttgcgggccagctttttcatcatagggcctctgttggcgcggctgggggtggcc
agagttcccctgcccggtggctgtgcgatcgggtctcgtcctgtggatctgcatgtgcgg
ggtctacaagccttgggggcaacggtccaaatcgagcatggggtggttcatgcctatgcc
cgtaaactgttgggaacccgtatttacctggactatcccagcgtcggtgccaccgagacc
ttgatgatggccgctacgctggcggatggagaaacggtgatcgagaacgccgcccaagag
ccggaggtggcggatctagcccgtttttgtcaagccatgggggcccgcattcgcggtgtc
ggcaccaatacggttgtggtggtaggggtgccccgcttgcatggaacagagtacacggtc
attcccgaccgcatcgaggccagcacctatctcattgccggggccattacccgctctcac
ctcacggttggccctgttattcccgatcatctgcgggcggtgatcgccaagttgcaagcc
atgggtctgcgggtggaagaagagggcccaaaccggttgcgcattgccccagctcaactg
agctcaggctggctctgtcaggcaaccgatattcaaacgctgccctatcccggtttcccc
accgatgtgcaggcgccgatcatggctttggccgccttgagcgagggcagttgcaccatt
gaggagacagtgtttgaaaaccgcatgcaccacattcccgagctgaatcgcatgggagcc
gatattcgcctgaagaaccgagtggccctgatccgaggggtgccgtccctttccggcgct
ccggtggtggctaccgacctgcgggcgggtgcggccctggtgttggccggtctggcggct
gaaggctgctccacgatccacggattgcactacatcgaccggggctacgaagccattgat
gaaaagctgcgcagtgtcggggccaaggtgtaccgcagcgaaagcccgacagggatcccg
caattggggaaatga

DBGET integrated database retrieval system