KEGG   Synechococcus sp. JA-2-3B'a(2-13): CYB_0107Help
Entry
CYB_0107          CDS       T00319                                 

Gene name
chlI
Definition
(GenBank) magnesium chelatase, ATPase subunit I
  KO
K03405  magnesium chelatase subunit I [EC:6.6.1.1]
Organism
cyb  Synechococcus sp. JA-2-3B'a(2-13)
Pathway
cyb00860  Porphyrin and chlorophyll metabolism
cyb01100  Metabolic pathways
cyb01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cyb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CYB_0107 (chlI)
Enzymes [BR:cyb01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     CYB_0107 (chlI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mg_chelatase MCM AAA_5 AAA_16 AAA_22 Sigma54_activat AAA_29 AAA DUF815 AAA_18 ABC_tran AAA_28 AAA_30 AAA_27 AAA_23 AAA_19
Motif
Other DBs
NCBI-ProteinID: ABD01108
CyanoBase: CYB_0107
CYORF: CYB_0107
UniProt: Q2JHR0
Position
121855..122913
Genome map
AA seq 352 aa AA seqDB search
MHLERRPVFPFTAIVGQEEMKLALLLNVIDPRIGGVLIMGDRGTGKSTTIRALADLLPQI
EVVKGDPFNSHPRQRDLMSDQVWERLQAGETLESTWIQVPMVDLPLGATEDRVCGTLDIE
RALAQGVKAFEPGLLAKANRGILYVDEVNLLDDHLVDVLLDAAASGWNTVEREGISIRHP
ARFVLVGSGNPEEGELRPQLLDRFGMFVQIETVRDAALRVRIVEERSQFDADPQAFLAKY
ADSQQRLRERIEKAQHLLPNVAVDPDLRLKISGVCAALEVDGLRGDIVTNRAAKALAALE
GRSEVTVADIRRVISLCLRHRLRKDPLETIDSGYKVEKAFSEVFQVSLESAA
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgcatttggaacgtcgcccggttttcccgtttacggccatcgtcggccaagaggagatg
aaattggccttgctcctcaacgtgatcgacccgcgcattggcggggtgctgatcatgggg
gatcgcggcacgggcaaatccaccaccatccgcgctttggccgacctgctgccccagatc
gaggtggtgaaaggggatcccttcaacagccacccgcggcagcgggacttgatgagcgat
caagtgtgggagcgcctgcaggcgggagaaacgctggaaagcacttggatccaggtgccg
atggtggatctgcccttgggggcaacagaagaccgggtgtgtggcactctcgacattgag
cgggccttggctcagggggtgaaggcttttgagccagggctactagccaaggccaatcga
ggcatcctttacgtggatgaagtcaatttgctggatgaccacttagtggatgtgttgctg
gacgcggcggcctcaggctggaacaccgtggaacgggagggcatttccattcgtcatccg
gctcggtttgtgctggtgggatccggcaacccggaagagggggaattgcggcctcaactg
ctggatcgctttggcatgtttgtccagatcgaaacggtgcgagatgctgccctgcgggtg
cggatcgtggaggagcgcagccagttcgacgccgatccccaggcttttttggccaagtat
gccgattcccagcagcgcctgcgggagcgcatcgaaaaagcccaacatcttttgcccaac
gtggcagtggatcccgacttgcgcttgaagatctccggagtatgtgcggctttggaggtg
gatgggctgcgcggagacattgtcaccaaccgggctgccaaggccctggcagctctagag
gggcgcagtgaggtcaccgtcgccgatatccgtcgggtgatcagcctgtgtttgcgtcac
cgcctgcgcaaggatcccttggaaaccatcgactcgggctacaaggtggaaaaagccttc
agcgaagtgttccaggtgagcctagagagcgccgcctag

DBGET integrated database retrieval system