KEGG   Synechococcus sp. JA-2-3B'a(2-13): CYB_0107Help
Entry
CYB_0107          CDS       T00319                                 

Gene name
chlI
Definition
magnesium chelatase, ATPase subunit I (EC:6.6.1.1)
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
cyb  Synechococcus sp. JA-2-3B'a(2-13)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cyb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CYB_0107 (chlI)
Enzymes [BR:cyb01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     CYB_0107 (chlI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
CyanoBase: 
CYORF: 
UniProt: 
Position
121855..122913
Genome map
AA seq 352 aa AA seqDB search
MHLERRPVFPFTAIVGQEEMKLALLLNVIDPRIGGVLIMGDRGTGKSTTIRALADLLPQI
EVVKGDPFNSHPRQRDLMSDQVWERLQAGETLESTWIQVPMVDLPLGATEDRVCGTLDIE
RALAQGVKAFEPGLLAKANRGILYVDEVNLLDDHLVDVLLDAAASGWNTVEREGISIRHP
ARFVLVGSGNPEEGELRPQLLDRFGMFVQIETVRDAALRVRIVEERSQFDADPQAFLAKY
ADSQQRLRERIEKAQHLLPNVAVDPDLRLKISGVCAALEVDGLRGDIVTNRAAKALAALE
GRSEVTVADIRRVISLCLRHRLRKDPLETIDSGYKVEKAFSEVFQVSLESAA
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgcatttggaacgtcgcccggttttcccgtttacggccatcgtcggccaagaggagatg
aaattggccttgctcctcaacgtgatcgacccgcgcattggcggggtgctgatcatgggg
gatcgcggcacgggcaaatccaccaccatccgcgctttggccgacctgctgccccagatc
gaggtggtgaaaggggatcccttcaacagccacccgcggcagcgggacttgatgagcgat
caagtgtgggagcgcctgcaggcgggagaaacgctggaaagcacttggatccaggtgccg
atggtggatctgcccttgggggcaacagaagaccgggtgtgtggcactctcgacattgag
cgggccttggctcagggggtgaaggcttttgagccagggctactagccaaggccaatcga
ggcatcctttacgtggatgaagtcaatttgctggatgaccacttagtggatgtgttgctg
gacgcggcggcctcaggctggaacaccgtggaacgggagggcatttccattcgtcatccg
gctcggtttgtgctggtgggatccggcaacccggaagagggggaattgcggcctcaactg
ctggatcgctttggcatgtttgtccagatcgaaacggtgcgagatgctgccctgcgggtg
cggatcgtggaggagcgcagccagttcgacgccgatccccaggcttttttggccaagtat
gccgattcccagcagcgcctgcgggagcgcatcgaaaaagcccaacatcttttgcccaac
gtggcagtggatcccgacttgcgcttgaagatctccggagtatgtgcggctttggaggtg
gatgggctgcgcggagacattgtcaccaaccgggctgccaaggccctggcagctctagag
gggcgcagtgaggtcaccgtcgccgatatccgtcgggtgatcagcctgtgtttgcgtcac
cgcctgcgcaaggatcccttggaaaccatcgactcgggctacaaggtggaaaaagccttc
agcgaagtgttccaggtgagcctagagagcgccgcctag

DBGET integrated database retrieval system