KEGG   Synechococcus sp. JA-2-3B'a(2-13): CYB_0281Help
Entry
CYB_0281          CDS       T00319                                 

Gene name
psbB
Definition
photosystem II P680 chlorophyll A apoprotein
Orthology
K02704  
photosystem II CP47 chlorophyll apoprotein
Organism
cyb  Synechococcus sp. JA-2-3B'a(2-13)
Pathway
Photosynthesis
Metabolic pathways
Module
Photosystem II
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:cyb00001]
 Metabolism
  Energy metabolism
   00195 Photosynthesis
    CYB_0281 (psbB)
Photosynthesis proteins [BR:cyb00194]
 Photosystem and electron transport system
  Photosystem II (P680 chlorophyll a) [OT]
   Main subunits
    CYB_0281 (psbB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
295732..297264
Genome map
AA seq 510 aa AA seqDB search
MGLPWYRVHTVVLNDPGRLIAVHLMHTALVAGWAGSMALYETAIFDPSDPVLNPMWRQGM
FVMPFMVRLGVVNSWGGWNIYGESVANAGFWTFEGVATAHIVLSGLLFLAACWHWVYWDL
ELFRDPRTGEPALDLPKIFGIHLLLAGILCFGFGAFHLTGVFGPGMWVSDPYATTGHVQP
VAPEWGPAGFNPYNAGGVVAHHIAAGIVGIIAGLFHITVRPPQRLYRALRMGNIETVLSS
SIAAVFFAGFVVAGTMWYGSATTPVELFGPTRYQWDSGYFNQEINRRVNAAMEAGMTRSE
AYNSLPKSLLFYDYVGNSPAKGGLFRAGPMNKGDGIAIEWLGYPVFRDREGRELTVQRMP
NFFETFPVILRDADGVVRADIPFRRAESRYSFEQVGVTVEFYGGKLDGQVFTDPATVKKY
ARQAQLGQLFEFDRETPKADGTFHTSPRGWFTFAHAVFALLFFFGHIWHGARTLFRDVFA
GIDPNMSEEMVEFGVFQKVGDPTTRKVQEA
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgggactaccgtggtatcgggtccatacggttgtactgaatgacccaggtcgcctgatc
gcggttcacctgatgcataccgctctggtagcaggttgggccgggtcgatggcgctctat
gaaacggccattttcgatccgtcggatcctgtcctgaatccgatgtggcgtcagggcatg
tttgtcatgccatttatggttcgcctgggggtggtcaactcctggggcggttggaatatc
tacggcgagagcgttgccaatgcgggcttctggacgtttgaaggggtagccactgcccat
atcgttttgtccggcttgctcttcttggctgcctgctggcactgggtgtactgggatctg
gagctgttccgggatccccgcaccggcgagccggctttggatctgccgaaaatatttggg
atccacctgctgttggccgggatcctctgctttgggtttggcgcctttcacctgacgggg
gtgtttggcccggggatgtgggtgagcgatccctatgcgacgacggggcacgtccagccg
gtggcgccggaatgggggccagccggttttaacccctacaacgccggaggggtggtggcc
caccacattgctgcaggcatcgtgggcatcattgcaggtctatttcacatcacggtacgc
ccaccccagcgcctctatcgcgctctgcgaatggggaacatcgagacggtgctttccagc
tcgattgcggcggtgttttttgccggttttgtggtggccggaaccatgtggtacggcagc
gccaccactcctgtggagctgtttggccccacccgctaccaatgggattctggctatttc
aaccaggagattaaccgccgggtaaatgcggccatggaagccgggatgacccgcagcgag
gcctacaactccctgcccaagtctctgctcttctacgactacgtgggcaacagcccggcc
aaggggggactgttccgagctggccccatgaacaaaggggatggcattgccatcgagtgg
ctgggctacccggtgttccgtgaccgcgaagggcgggagctgacggtgcagcggatgccc
aacttcttcgagaccttcccggttatcctgcgggatgccgatggcgtggtgcgggcagac
attcctttccgtcgggcggagtcgcgctacagctttgagcaggtgggggtgacggtggag
ttttacggcggcaagctggacggccaggtgtttaccgacccggcaacggttaagaagtat
gcccgccaggcccagttgggtcagttgtttgagttcgaccgagaaacccccaaggcggac
ggcaccttccacaccagcccccgcggttggtttacctttgctcacgccgtctttgccctg
ctgttcttctttggccacatctggcacggcgctcgcactctcttccgcgatgtgttcgcc
ggtattgaccccaatatgagcgaggaaatggtggagttcggcgtcttccagaaagtaggg
gatcccaccactcgcaaggttcaggaagcctag

DBGET integrated database retrieval system