KEGG   Synechococcus sp. JA-2-3B'a(2-13): CYB_0338Help
Entry
CYB_0338          CDS       T00319                                 

Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
cyb  Synechococcus sp. JA-2-3B'a(2-13)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cyb00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    CYB_0338
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CYB_0338
  Lipid metabolism
   00071 Fatty acid degradation
    CYB_0338
  Amino acid metabolism
   00350 Tyrosine metabolism
    CYB_0338
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CYB_0338
   00626 Naphthalene degradation
    CYB_0338
Enzymes [BR:cyb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     CYB_0338
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(356719..357846)
Genome map
AA seq 375 aa AA seqDB search
MLSASPCQLDLAIPAPGRLYRGSGILEAVPLAVLGSRVLVIGGERSLAVVESPLQRNFAR
DPALQVHWTTYGVDCSESELARLQALAMAESTTGILGVGGGKALDTAKLVAHRLRIPVVT
VPTSAATCAAWSALSNIYSNSGAFQRDVALDQAPAALILDYDLIRQAPPRTLVAGIGDAL
AKWYESSVSSGSSEDALVIGAVQQARVLRDLLLQQSAAALREPGGTAWKQVVDACICLAG
IVGGMGGAKCRTVAAHAVHNGLTHLSGHRATLHGEKVAFGILAQLRLEEILQGSQLALAA
RTQLLEFYRQVGLPLNLRDLKLGHLGSADLLHAAQVACQPGSDIHHLPFPVSPEALLVAL
TTTDLTSSSPVLPRL
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgctaagcgcctctccttgccaattggatcttgccattccggccccaggtcggctgtac
cgcggcagcggcattctggaagctgtgccccttgcggtactgggatcccgtgtgctggtg
atcgggggggaacgctccttggctgtggttgagtcccctctgcagcgcaatttcgcgcgg
gatcccgccctccaagttcactggactacctacggggtagattgcagcgagtcggagctg
gcgcgtttgcaggcgctagccatggcggagtccacaaccggcatcttgggggtaggcggg
ggcaaggctctggatacggccaagctggtggcccaccggctgcggatccccgtggttacc
gtgcccacctctgctgccacctgtgccgcctggagtgccctatccaatatctactccaac
agcggcgcttttcagcgggatgtggccttggatcaggccccagccgccttgatcttggac
tacgacctcattcgtcaggctccccctcgcaccttggtagccgggatcggagatgccttg
gctaagtggtacgagtcttccgtcagcagcggcagttcagaagatgccctggtgattggc
gctgtgcagcaggcccgcgtcctgcgggatttgctcctccagcaatcggcggcggccttg
agggagccgggcggaaccgcttggaagcaggtggtggatgcctgcatctgcctggcgggg
atcgtcggcggcatgggtggggctaagtgtcgcaccgtggccgcccacgctgtccacaac
gggctaacccacttgtcggggcaccgggccaccctgcacggcgagaaggtggctttcggc
attttggcccagctccgcctagaagagatcctgcagggaagccagttggcgctggcagca
cgtacccagttgctggagttctaccgccaggtggggctgcccctcaacttgcgggatctc
aagctaggtcacttgggatccgccgacctgctgcatgctgcccaagtggcctgccagcca
ggatccgacatccaccacctgcccttccccgtcagtccagaagccctgttggtggccctt
accaccacagacctgaccagctccagccctgttctccctcggctgtaa

DBGET integrated database retrieval system