KEGG   Synechococcus sp. JA-2-3B'a(2-13): CYB_0546Help
Entry
CYB_0546          CDS       T00319                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
cyb  Synechococcus sp. JA-2-3B'a(2-13)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cyb00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CYB_0546 (ruvA)
Enzymes [BR:cyb01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     CYB_0546 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
558347..558961
Genome map
AA seq 204 aa AA seqDB search
MIAFLSGHLVAIEWGERSSLTVEVQGIGYRVKAPGRFLKQLPAVGEPVRVFTHLVVRETE
LVLYGFGSPAERDLFVELIKVSGVGPALGLALLNTFGLPELVQAVVTENVRLLSLTPGVG
HKTAQRLALELKTKLAHWRQGMGVADQPLAGGPPMPIREEVEMALLALGYSTQEIQAALQ
ALPTHPRPTEDWLRDAITYLSQQP
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcgtttttaagcggccaccttgtggccatcgaatggggagagcgcagcagcctc
accgttgaggtgcaggggatcggctatcgcgtcaaggccccaggacgttttctcaagcaa
ctgcccgcagtgggggagcccgtccgggtgttcacccatttggtggtgcgagagaccgag
ctggtgttgtacgggtttggctcgccagccgagcgcgatttgtttgtggaactcatcaaa
gtctcaggggtggggccggctttgggcttggccctgctgaataccttcggcctgccggag
ctggtgcaggcggtggtgaccgaaaatgtgcgcctgctctccctcacgccgggggtaggc
cataaaacggcccaacggctggccttggagctgaaaaccaagctggcccactggcgacag
gggatgggggttgcggatcaacccttggccggggggccgcccatgcccatccgagaagag
gtggaaatggccttactggccctgggctacagcactcaggaaattcaggctgccttgcaa
gctctgcccacccacccccgcccaacggaagactggctgcgggatgccatcacctacctg
agccagcagccatga

DBGET integrated database retrieval system