KEGG   Synechococcus sp. JA-2-3B'a(2-13): CYB_0566Help
Entry
CYB_0566          CDS       T00319                                 

Gene name
cobA_hemD
Definition
(GenBank) uroporphyrin-III C-methyltransferase/uroporphyrinogen-III synthase
  KO
K13542  uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
cyb  Synechococcus sp. JA-2-3B'a(2-13)
Pathway
cyb00860  Porphyrin and chlorophyll metabolism
cyb01100  Metabolic pathways
cyb01110  Biosynthesis of secondary metabolites
cyb01120  Microbial metabolism in diverse environments
Module
cyb_M00121  Heme biosynthesis, glutamate => heme
Brite
KEGG Orthology (KO) [BR:cyb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CYB_0566 (cobA_hemD)
Enzymes [BR:cyb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     CYB_0566 (cobA_hemD)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     CYB_0566 (cobA_hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 TP_methylase
Motif
Other DBs
NCBI-ProteinID: ABD01557
CyanoBase: CYB_0566
CYORF: CYB_0566
UniProt: Q2JNU8
Position
complement(575976..577478)
Genome map
AA seq 500 aa AA seqDB search
MGKVYLVGAGLGGRAGLTQGALEILRQAEAIWIDELVDERLLAELPPQAQVWRRSGPGSL
QEGIHWLIQRCREGKQVVHLKSGDPLIFGRAREEIQALREAGCPFEIWPGLSSALAGPLW
AGIPLTDKHLSRVFAVLTAHDLEALPWSALAQLDTLVILMGSRQRQHIGARLMESGIPAD
RPVALIWGAGQAEQQVWVGTLAELQQGESQAKLPGLLVVGEVIRLRQDFLPGIPPLPPPA
PLAGKTVLVTRSEGQSPAFRELLQAQGARVLEMPTLVIQPPTCWDPLDAAIARLGQFNWL
LLTSANGVQAFFERLHRQGRDSRALHPVQVAVVGSKTASVLAQYGIHPDLMPQEFVAEAL
LQVWPEPISGQRILFPRVESGGREEVVQGLRQRGAEVVEVAAYQSACPAAADPQVLEALK
AHQVDILTFASSKTVQHFAHLIRQAGLGPEIWDPPVQIAAIGPKTAATCKAAFGRVDIAA
QEYTLEGLVEALIQATNRST
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaggtgtatctagtgggggcagggctgggcgggcgggcgggcctgacgcaggga
gcactggagatcctacggcaggctgaggctatctggatcgacgagctggtggatgagcgc
ttgttggcagagttgccgccgcaggcgcaggtgtggcgacgctctgggccaggaagcctc
caggagggcatccactggctcatccagcgctgccgagaaggcaaacaggtggttcacctc
aagtcaggggatcccttgatctttggccgcgctcgcgaagagatccaagcccttagggag
gcgggctgtccctttgagatttggccggggttgtcgtcggccctggctggccccctctgg
gcagggatccccctgaccgataagcacttaagccgcgtttttgccgtgctgactgcccac
gatctagaggccttgccctggagcgccctggcccagttggatactttggtgattttgatg
ggatcccggcagcgacagcacattggcgcacggctgatggagtctgggatcccggcagac
cgaccggtggccttgatctggggggcggggcaagcagagcagcaggtgtgggtgggcacc
ttggccgagctgcagcagggggagagtcaggcaaagttgccgggcctactggtggttggg
gaggtgatccggttgcggcaggactttttgccggggatccctcctttgcctccgccggct
cccctggcaggcaagacggtgctggttacccgttctgaggggcaatcgccagcttttcgg
gagctgctacaggcccagggagcgcgggtgctggaaatgcccaccctggtgatccagccg
cccacctgttgggatcccttggatgccgccattgcccgcctgggccaattcaactggctg
ttgctgacttcggccaacggggtgcaggctttctttgagcggttgcaccggcaaggtcgg
gacagtcgggctctccaccccgtacaagtggcggtggtgggatccaagaccgcttccgtg
ctcgcccagtacggcatccatcccgatctcatgccccaagagtttgtggccgaggccctg
cttcaagtttggccggagccgatctcagggcagcggattctctttcccagagtggagtcg
ggaggccgggaggaggtggtacagggtttgcggcagcgaggggcagaggtggtggaggtg
gccgcctatcagtctgcctgtccagcagcagcggatccccaggtcctggaagctcttaaa
gcccaccaggtggacatcctcacctttgccagctccaagacagtacagcattttgcccac
ttgatccggcaggcagggctaggccctgagatctgggatccacccgtgcagattgccgcc
attggccccaagacggccgcaacctgcaaggctgcatttggtcgagtggacatcgcagcc
caggagtatactttggaaggattggtggaagccctcatccaagcgaccaaccgttctacc
tag

DBGET integrated database retrieval system