KEGG   Synechococcus sp. JA-2-3B'a(2-13): CYB_0684Help
Entry
CYB_0684          CDS       T00319                                 

Gene name
phoD
Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
cyb  Synechococcus sp. JA-2-3B'a(2-13)
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cyb00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:cyb00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:cyb02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
CyanoBase: 
CYORF: 
UniProt: 
Position
698177..699904
Genome map
AA seq 575 aa AA seqDB search
MSSLRSRRFFLQLLMFGGGAAALAACGGTSSSSIPPLGEPGFPQGVFAGDPTSEGAVLST
RVIPASATDTVAVTLQVAENSEFNPISQQVSLTARRVAGRNYRTEPGDYIARAVVTGLRP
AQRYFYRFVSEGFTSPVGQFRTLPAPGDGRPIRFLHISCANEPPFPIGAAMLAEVSRGDI
DFISFNGDTVYADRFWLGLDPIGNLEFYRSLYRDQRDPNYAGREFAQLFGRTSFVVNWDD
HEVIDNYSGQKARGGRATQLNDTTGQTRDVEDLKVLGYQAFFEYNPITPNLTDVAGVDSR
DRLFRSFRYGANAEVFILDLRQYRDLAAVTPILPILPPGLTRQRFLELAGIRLTPEQETL
FFGPPGSEQALFNLLRRTPRTLLGNPQKQWLFNGLRNSTATYKFIVSEFPITVTYFRSND
VWEGYWLERQEVIDFIESNNIRNVVFLTGNNHAGFIGQVNPGSSNPIWEVWTGPTGRSVT
ALSIDELGNQLGIPNASRLYYRIVNGFLAPVNPTNPQVSGIPGVTTGNLRFLELAVPNYN
VIEVSGSRCTIQIKGPTGSVLTDPLGRRGELNLPQ
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgagttccctgcgttcccgtcgctttttcctgcagttgctgatgtttggaggtggggca
gccgccctggctgcctgtggaggcacctccagttcctcgattccccccctgggagagcct
ggatttccccaaggggtatttgccggggatcccacctcggaaggggcggtgctttccacg
cgggtgatcccggccagcgcgacagatacggttgcggtgacgttgcaggtggctgagaat
tccgagttcaaccccatttcgcaacaagtttcgcttactgctcgccgtgtggcgggccgc
aactaccgcactgagccaggcgactacattgcccgcgccgtcgtcaccggcttgaggcca
gcgcagcgctacttctaccggtttgtcagcgaggggtttaccagccctgtaggccagttt
cgcaccctgccagctcctggggatggacgacccattcgcttcttacacatcagttgtgcc
aacgagcctccctttcctattggggcagccatgctggcagaagtcagccgcggcgatatc
gatttcatttcctttaacggcgataccgtctacgccgatcgcttctggctggggttagat
cccatcggcaatctggagttctaccgcagcctctatcgggatcagcgggatcccaactat
gccgggcgggagttcgcgcaactgtttggccggacttcctttgttgtcaactgggacgat
cacgaggtgattgacaactacagtggccagaaggcccgcggtggccgggccactcagctg
aacgacaccaccgggcaaacccgcgatgtggaagatctcaaggtgctgggctaccaggct
ttttttgagtacaaccccattacccccaacctgacagatgtggccggtgtggatagccgg
gatcggctgtttcgcagcttccgctacggggccaatgccgaagtctttatcctggatctg
cgccagtaccgggatttggcggcggtcacccccattttgcccattttgccccccggcctg
acccggcagcgctttttggagctggctggcattcgtcttacgcccgaacaggaaaccctt
ttcttcggcccacccggctccgaacaagccctgtttaacctgctgcgccgcacgccccgt
accctcttgggcaatccgcagaagcagtggctgttcaacggcctgcgcaactccaccgcc
acctacaagttcatcgtcagcgagtttcccatcacggtgacctatttccgctccaacgat
gtttgggaaggctactggctggagcggcaggaagtcattgactttatcgagagcaacaac
atccgcaacgtggtgttcttgaccggcaacaaccatgccggcttcatcggacaggtcaac
cccggcagcagcaaccccatctgggaagtgtggactggccccaccgggcggagcgttacg
gccctgagcattgacgagctgggcaatcaactggggatccccaatgccagccgcctgtat
taccggattgtgaacggctttttggcaccggtgaacccgaccaatccgcaagtgagcggg
atcccaggggtaacgacgggcaacttgcgctttttggagctggcggtgcccaactacaac
gttattgaagtgtccggcagccgctgcaccattcaaatcaaaggccctaccggcagtgtt
ttgacggatcccttagggcgaaggggggaactgaatttgccgcaatga

DBGET integrated database retrieval system