KEGG   Synechococcus sp. JA-2-3B'a(2-13): CYB_0861Help
Entry
CYB_0861          CDS       T00319                                 

Definition
fatty acid desaturase (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
cyb  Synechococcus sp. JA-2-3B'a(2-13)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:cyb01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:cyb01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(894187..895071)
Genome map
AA seq 294 aa AA seqDB search
MTTSFSRQSLNHPAPLIQPEPQESFRFAWEHVLFFAIFHVVALVGGIFFFSWPALGVALF
LHWCFGSLGICLGYHRLLSHRSFQVPKWLEYVFTTLGALAVQGGPIFWVGGHRQHHAFTE
DEEKDPYSARKGFWWSHILWLIYHREEFFNPEKYSAFAPDLARDPFYRWLDRYALLLQLP
LAAILYLLGGWSFVVYGIFVRTVLLLHCTWLINSASHFWGYRTFESNDNARNLWWAAILT
YGEGWHNNHHADPKCVKAGLRWWEIDMTYWAIWLLARLGLARKLHLPAQGQAAR
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgaccacttctttttctcgccaatcgctgaatcatcccgctccgctcattcagcccgag
ccccaagagtcctttcggtttgcttgggaacatgtgctcttctttgccatctttcacgtg
gtggctttggtgggaggcattttcttcttctcctggcccgctctgggagtagccctattt
ctccactggtgtttcggcagcttaggcatctgcttggggtaccaccgcctgctcagccat
cgtagtttccaggtgcccaagtggctggaatatgtcttcacgactctcggtgccctggcc
gttcaaggggggccgatcttttgggtgggcggccatcgtcagcaccacgccttcaccgaa
gacgaggagaaggatccctattctgctcgtaagggcttttggtggagccacatactctgg
ctgatctaccaccgcgaagaatttttcaaccctgagaagtattctgcctttgcgccggac
ttggctcgggatcccttctaccgctggctggataggtacgccctgcttctgcagctgcca
ttggccgcgatactctacctgctgggaggctggtcattcgtcgtgtacggtatctttgtg
cggacagtgctgctactgcattgcacctggttaatcaactcggccagccacttctggggt
taccggactttcgagagcaatgacaatgctcgtaacctttggtgggcggccattctaacc
tatggtgaaggctggcacaacaaccatcatgccgacccgaagtgcgttaaggccggtttg
cgttggtgggagatcgacatgacctactgggccatttggctgttggcgagattgggcctg
gctcgtaagctgcacctgcctgcccaaggccaagctgctcgctga

DBGET integrated database retrieval system