KEGG   Synechococcus sp. JA-2-3B'a(2-13): CYB_0937Help
Entry
CYB_0937          CDS       T00319                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cyb  Synechococcus sp. JA-2-3B'a(2-13)
Pathway
cyb00260  Glycine, serine and threonine metabolism
cyb00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cyb01100  Metabolic pathways
cyb01110  Biosynthesis of secondary metabolites
cyb01130  Biosynthesis of antibiotics
cyb01230  Biosynthesis of amino acids
Module
cyb_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cyb00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CYB_0937 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CYB_0937 (trpA)
Enzymes [BR:cyb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CYB_0937 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB ThiG FMN_dh NanE TMP-TENI
Motif
Other DBs
NCBI-ProteinID: ABD01916
CyanoBase: CYB_0937
CYORF: CYB_0937
UniProt: Q2JHJ9
Position
975617..976432
Genome map
AA seq 271 aa AA seqDB search
MPSRITACFQALRSRGEAALIPYLTAGDPNLETTFEALQVLDQSGADLIELGVPYSDPLA
DGPVIQAAATRALSRGVTLGAILQGLRCLSLQAPLILFTYYNPIHQLGIPNFLHQLRQAG
CAGLVVPDLPLEEAGSLRQAAQAEEIDLILLVAPTSPPERMRRIAQQSSGFVYLVSTTGV
TGERATLEKRIPALLQQLRQQTPLPIGVGFGISTPDQARQIALWGADAAIVGSAFVQRLA
KAPTPEEGLQQIAHFCRALKAALQEVTTPER
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgcccagccggatcacagcctgtttccaggcgctgcgcagccgcggtgaagcagccctc
atcccctacctcaccgccggggatcccaacttggaaaccacctttgaggctttgcaggtt
ctggatcagagcggcgccgatcttatcgagctgggggtaccctactcggatcccttggcc
gatgggccggtgatccaagcagcagccacccgcgccctcagtcggggagtcactttgggc
gccattctacaaggcttgcgctgtctctcgctgcaggcccccctgatcctgttcacctac
tacaaccccatccaccagctcggcatccccaactttctgcatcaactgcggcaggccggc
tgtgccggcttggtcgtccccgatctgcctctggaagaggcgggatccctgcgacaagca
gcccaggccgaagagatcgacctcatcctgctggtggcccccaccagccccccggagcgc
atgcgccgcattgcccagcagtccagtggctttgtctacttggtcagcaccaccggcgtt
accggcgaacgggccaccctggaaaagcggatcccggctttgctgcagcaactgcgccaa
caaacccccctgccgattggggtgggcttcggcatctccactcccgaccaggcccgccag
atcgctctctggggagcagatgcagcgattgtgggcagcgcatttgtgcaacggctggcc
aaagcccccacgcctgaagaaggactgcagcaaatagcccacttttgtcgagccctcaaa
gcggctctgcaagaggtgaccactccagagcgctga

DBGET integrated database retrieval system