KEGG   Synechococcus sp. JA-2-3B'a(2-13): CYB_0974Help
Entry
CYB_0974          CDS       T00319                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
cyb  Synechococcus sp. JA-2-3B'a(2-13)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cyb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CYB_0974 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CYB_0974 (glk)
   00052 Galactose metabolism
    CYB_0974 (glk)
   00500 Starch and sucrose metabolism
    CYB_0974 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    CYB_0974 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CYB_0974 (glk)
   00524 Butirosin and neomycin biosynthesis
    CYB_0974 (glk)
Enzymes [BR:cyb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     CYB_0974 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1009689..1010732
Genome map
AA seq 347 aa AA seqDB search
MDLLLAGDIGGTKTSLSLVNAEDPEHSLYHCRYASQDYANLAPMVGEFLAQARRELGRDP
QPAAACFAVAGPVMETRGSGSEGQTAKVTNLPWDLQSSQLAAELGIPRVALINDFSAVGY
GVLALGDQDLDTLQVGERQPRAPIGVMGAGTGLGQAYLTWGEGGYQVHASEGGHVDFSPR
TPLEWELLRYLQKRHGRVSTERVVSGQGIVAIYQFLRDSQWGSGEEQLLAQIEAWEKGAK
HIDPAAQIANAAMEARDPLAVECLRLFISLYGAAVGNFALHLLPRGGLFIAGGIAPKLLR
LLHQGEFLSSFLDKGRMRPLLEQLSVQVVVNAQVGLRGAARYAANLL
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atggacttgttgttggcaggagacatcgggggcaccaaaaccagcctcagccttgtcaat
gccgaggatcccgagcacagcctttaccactgccgctatgccagccaagattacgccaac
ctcgccccaatggtgggagagtttctggcccaggctcggcgggagctggggcgagatcca
cagcctgctgccgcctgttttgcagtggccggccccgtcatggaaacaaggggctcaggg
tctgagggacagactgccaaagtgaccaacttgccctgggatctgcagtcgagccaattg
gccgcagagctggggatcccgcgcgtagccttgatcaacgacttcagcgccgtagggtat
ggcgtgcttgccctcggcgaccaggatctggacaccttgcaagtgggtgagcgtcaaccg
cgggctccgattggcgtgatgggagcaggcacgggtttggggcaggcttaccttacctgg
ggagaagggggttaccaagttcatgccagcgagggcggtcacgtggacttttccccgcgc
acccctctggagtgggagctcttgaggtatttgcaaaaacggcacggacgtgtctccacc
gagcgggtggtctcggggcaggggatcgttgccatttatcaatttttgcgggatagccag
tggggctcaggagaagaacagctgctggcccaaattgaggcttgggaaaagggagctaag
catattgacccggcagcccaaattgccaatgctgccatggaagcacgggatcccctggcg
gtggagtgtctgcggcttttcatcagcctgtacggggctgcagtcgggaactttgcccta
cacctattgccgcgcgggggcctgttcatcgctggggggatcgcgcccaagctcttgcgc
ctactgcatcaaggggagtttttgtcctcgtttttggataaggggcggatgcgtcctctt
ctagagcaactgtcggtgcaggtggtggtgaatgcgcaggtggggctgaggggagctgct
cgctacgccgccaaccttttgtga

DBGET integrated database retrieval system