KEGG   Synechococcus sp. JA-2-3B'a(2-13): CYB_0974Help
Entry
CYB_0974          CDS       T00319                                 

Gene name
glk
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
cyb  Synechococcus sp. JA-2-3B'a(2-13)
Pathway
cyb00010  Glycolysis / Gluconeogenesis
cyb00052  Galactose metabolism
cyb00500  Starch and sucrose metabolism
cyb00520  Amino sugar and nucleotide sugar metabolism
cyb00521  Streptomycin biosynthesis
cyb01100  Metabolic pathways
cyb01110  Biosynthesis of secondary metabolites
cyb01120  Microbial metabolism in diverse environments
cyb01130  Biosynthesis of antibiotics
cyb01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cyb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CYB_0974 (glk)
   00052 Galactose metabolism
    CYB_0974 (glk)
   00500 Starch and sucrose metabolism
    CYB_0974 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    CYB_0974 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CYB_0974 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    CYB_0974 (glk)
Enzymes [BR:cyb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     CYB_0974 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: ABD01952
CyanoBase: CYB_0974
CYORF: CYB_0974
UniProt: Q2JMT0
Position
1009689..1010732
Genome map
AA seq 347 aa AA seqDB search
MDLLLAGDIGGTKTSLSLVNAEDPEHSLYHCRYASQDYANLAPMVGEFLAQARRELGRDP
QPAAACFAVAGPVMETRGSGSEGQTAKVTNLPWDLQSSQLAAELGIPRVALINDFSAVGY
GVLALGDQDLDTLQVGERQPRAPIGVMGAGTGLGQAYLTWGEGGYQVHASEGGHVDFSPR
TPLEWELLRYLQKRHGRVSTERVVSGQGIVAIYQFLRDSQWGSGEEQLLAQIEAWEKGAK
HIDPAAQIANAAMEARDPLAVECLRLFISLYGAAVGNFALHLLPRGGLFIAGGIAPKLLR
LLHQGEFLSSFLDKGRMRPLLEQLSVQVVVNAQVGLRGAARYAANLL
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atggacttgttgttggcaggagacatcgggggcaccaaaaccagcctcagccttgtcaat
gccgaggatcccgagcacagcctttaccactgccgctatgccagccaagattacgccaac
ctcgccccaatggtgggagagtttctggcccaggctcggcgggagctggggcgagatcca
cagcctgctgccgcctgttttgcagtggccggccccgtcatggaaacaaggggctcaggg
tctgagggacagactgccaaagtgaccaacttgccctgggatctgcagtcgagccaattg
gccgcagagctggggatcccgcgcgtagccttgatcaacgacttcagcgccgtagggtat
ggcgtgcttgccctcggcgaccaggatctggacaccttgcaagtgggtgagcgtcaaccg
cgggctccgattggcgtgatgggagcaggcacgggtttggggcaggcttaccttacctgg
ggagaagggggttaccaagttcatgccagcgagggcggtcacgtggacttttccccgcgc
acccctctggagtgggagctcttgaggtatttgcaaaaacggcacggacgtgtctccacc
gagcgggtggtctcggggcaggggatcgttgccatttatcaatttttgcgggatagccag
tggggctcaggagaagaacagctgctggcccaaattgaggcttgggaaaagggagctaag
catattgacccggcagcccaaattgccaatgctgccatggaagcacgggatcccctggcg
gtggagtgtctgcggcttttcatcagcctgtacggggctgcagtcgggaactttgcccta
cacctattgccgcgcgggggcctgttcatcgctggggggatcgcgcccaagctcttgcgc
ctactgcatcaaggggagtttttgtcctcgtttttggataaggggcggatgcgtcctctt
ctagagcaactgtcggtgcaggtggtggtgaatgcgcaggtggggctgaggggagctgct
cgctacgccgccaaccttttgtga

DBGET integrated database retrieval system