KEGG   Synechococcus sp. JA-2-3B'a(2-13): CYB_1116Help
Entry
CYB_1116          CDS       T00319                                 

Definition
branched-chain alpha-keto acid dehydrogenase subunit E2
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cyb  Synechococcus sp. JA-2-3B'a(2-13)
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:cyb01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cyb00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:cyb00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:cyb00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1153962..1155236
Genome map
AA seq 424 aa AA seqDB search
MIHELSMPALSSTMETGKIVTWLKNPGDRVEKGENILVVESDKADMDVESFHSGILASIL
VPAGESAPVGAPIALIAESEAEVAQAQEKAKALAAGVTPAAPPSADRASAAQPTSPAPAA
TPTSTLPNGSDGAGSQRIVASPRAKKLAESLGIDLRTVRGSGPNGRIIAEDVERAAALSA
PAVAAPSAPAPAPPTPVAVPLGETVPLSTLQAAVVRNMNASLGVPVFHVGYTITTDSLDH
LYQQVKPKGVTLTALLVKAVAMTLEKHPLLNASYTEGGIHYKSDINIAVAVAMEDGGLIT
PVLKQANRLDLYEISRRWKDLVERARRKQLQPEEYNSGTFTLSNLGMFGVDRFDAILPPN
QGSILAIGASRPTVVATPEKAIAIRSQMQVNLTCDHRVIYGAHAAAFLQDLAQLIEHKVG
SLTL
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgatccacgaactctccatgccggccctcagctccaccatggaaacgggcaagatcgtc
acctggctgaaaaaccccggcgaccgcgtggagaaaggagaaaacatcctggtggtggag
tccgacaaagcggacatggacgtggagtccttccacagcggcatcctggccagtatcctg
gtgccggcaggggaatcagccccggtgggcgcccccattgccctgattgccgaaagcgaa
gcggaagtggcccaagctcaggaaaaagccaaagccctcgctgctggcgttacccctgcg
gctccacctagcgcagaccgcgcctctgcagctcagccgacaagtcctgcccctgcggca
acccccacctctacactgccaaatggatcggatggcgccggatcccagcggatcgtggct
tccccgcgggcgaaaaaattggcggaaagcctggggatcgatctgcgcaccgtgcgcggc
tccggccccaacggtcgcatcatagccgaagacgtggagcgagctgcggccctttccgct
cctgcagtggctgccccctctgctccagcccccgcgcctccaactcctgtagctgtcccc
ttgggagaaacggttcccctcagcactttacaagcggcggtggtgcgcaacatgaacgcc
agccttggcgtgccggtgttccacgtgggctacaccatcaccaccgatagcctggatcac
ctctaccaacaggtaaagcctaagggggtgaccctgacggccctcttggtcaaagccgtg
gccatgaccctggagaagcatccccttttgaatgccagctacacagaaggcgggatccat
tacaaatcggatatcaacatcgccgtggccgtggccatggaggatggcgggctgatcacc
cctgtcctaaagcaagccaaccggctcgatctgtacgagatctcccgccgctggaaggat
ctggtggagcgggcgcggcgcaagcaactgcagccggaagagtacaatagcggcaccttc
accctctccaacctgggcatgttcggggtggatcgcttcgatgccattttgccccccaac
cagggatccattttggccatcggcgcttctcgccccacggtggtggcgacgccggaaaaa
gccattgccatccgttcccaaatgcaggtgaacctcacctgtgatcaccgtgtcatctac
ggcgcccatgcagcggctttcctgcaggatctggcgcagctcatagagcacaaggtggga
tccctgacgttgtag

DBGET integrated database retrieval system