KEGG   Synechococcus sp. JA-2-3B'a(2-13): CYB_1198Help
Entry
CYB_1198          CDS       T00319                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
cyb  Synechococcus sp. JA-2-3B'a(2-13)
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:cyb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CYB_1198
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    CYB_1198
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    CYB_1198
Enzymes [BR:cyb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     CYB_1198
Exosome [BR:cyb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CYB_1198
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1242592..1243941
Genome map
AA seq 449 aa AA seqDB search
MLATRSYSLRAALAATVCVLSSSVFSSSLAQAAPQPTGNGAIFFHPDGTSASHWDITRIL
HYGPDGFLNWDRLPVITTYRGHLFDQLGGTSNAGAVTHATGTRAHAKSFGLDPDGKEYSS
ANGTLNTIMEEAVAAGLGTALVQTGSIIEPGTAAFVAKAAKRSDYEEIALQVVESGVDII
LGAGEEWLLPEGVQGRFGKGKRKDGRNLIEEAKKKGYAVVYTRDELLKLPADVSKVLGVF
NVEDTFYDKPEEELRKENLPNYIASAPTIAEMTEFALARISRNPKGFFAVIEEEGTDNMC
NNLNASGCLEAMKRADDAIGVILNFIEKNPKTFMITTSDSNAGGMQLVDIESAEEPLPPT
DPKGSGAPIDGVDGTGTKPFISAPDKNGKRFPFAVAWATGDDVGSGVIARAAGLNARELV
PVTGILNTDIYRILYFVLFGERIPSELKP
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
gtgctagctacgcgtagctattctctgagggcagcgttggctgcgactgtatgcgttttg
tcttcttccgtcttctcctctagcctggctcaagcagcgcctcagccgaccggaaacggg
gccatcttcttccacccggatggcacttcggcttctcactgggacatcacacgcattctc
cactacggccccgatggctttctgaactgggatcgtcttcccgtgattaccacctatcgc
gggcaccttttcgaccagcttgggggaacttccaacgccggagcggtgacccatgccaca
ggaactcgtgcccacgccaagagctttgggttggatccggacggcaaagagtactcctct
gccaacggcaccctgaacacgatcatggaagaggctgtggcggcaggcttgggtacggct
ctggtgcaaacgggatccatcattgagccggggacggctgccttcgttgccaaagctgcc
aagcgcagcgactatgaggagattgccctgcaggtggtggagtcaggggtagacatcatc
ctcggcgctggcgaggaatggctgctgccggaaggtgtccagggccgctttggcaaaggg
aagcgcaaggatggccgcaacctgattgaggaggccaagaaaaaggggtacgccgttgtc
tacacccgcgacgagctgctcaagctgccggcagatgtctccaaggttttgggggtgttc
aacgtcgaggacaccttctacgacaagcctgaagaagagttgcggaaagaaaacttgccc
aactacatcgccagcgcccccaccattgccgagatgaccgaatttgccctggcgcggatc
tcccgcaatcctaagggcttcttcgccgtcatcgaagaagagggcactgataacatgtgc
aacaacctcaatgcctctggctgcctggaggccatgaagcgggccgacgatgccatcggg
gtgattctcaactttatcgagaagaatcccaagaccttcatgattaccaccagcgacagc
aacgccggcgggatgcagttggtggatatcgaatccgccgaggagccgctgccccctact
gaccccaaaggcagtggtgcccccattgacggagttgacggcacgggcacaaagccgttt
atttctgctcctgacaagaatggcaagcgctttccctttgccgtggcttgggctaccgga
gatgacgtcggcagtggagtcatcgctcgcgctgcgggcctgaacgctcgagagctagtg
ccggtcactggaatcctgaacacagacatctaccgcattctctacttcgtgctctttggg
gagcgcatccccagcgagctgaagccctag

DBGET integrated database retrieval system