KEGG   Synechococcus sp. JA-2-3B'a(2-13): CYB_1353Help
Entry
CYB_1353          CDS       T00319                                 

Gene name
rbsK
Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
cyb  Synechococcus sp. JA-2-3B'a(2-13)
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:cyb00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CYB_1353 (rbsK)
Enzymes [BR:cyb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     CYB_1353 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1421431..1422348
Genome map
AA seq 305 aa AA seqDB search
MAGPIRVVGSLNMDLVVQVPHHPGPGETVLGSDYATYPGGKGANQAVAAARAGAQVEMWG
AVGSDEFGRLLQENLEHNGVDTRHLRQLEGPSGLALITVDPGGQNRIVVSPGANGRYLPE
HLPPFTPAALLLLQLEIPLPTVQAAAEQASAQGIPILLNPAPIVPLPGSLLRQVRYLVLN
ETEAAALAQSPVETPEQAQKVAQELQKHGIPAVILTLGGAGLVWADGEESGHWPAHPVEV
VDTTAAGDGFCGALAACLAAGGSLREALRFANAAAALVVTRAGAQPSLPQRSEIEAFLAS
AVETA
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atggcaggcccgatccgagtggtgggtagcttgaacatggatttggtggtgcaggtgccc
catcatcccggccctggggaaacggtgctgggatccgactacgccacctaccctggcggt
aagggagccaatcaagcggtggcagcggcgcgggcgggagcccaggtggaaatgtgggga
gcggtgggatccgatgagtttgggcgtctgctccaagagaacctggagcacaacggcgtg
gatacccgccacctgaggcagttggaggggcccagcggcctagctttgatcacagtggat
cccggcgggcaaaacagaatcgtggtcagccctggagccaatggtcgctatctgccggag
catttgcctccctttaccccagcggccctgctcctgctgcagctggaaatccccctgccc
actgtgcaggctgcagcagaacaagcctctgcccaagggatcccgattttgctcaaccct
gcgcccatcgtgccattgccaggatccctgttgcgccaggttcgctacttggtgctcaac
gaaaccgaagcggctgcccttgcccaatcccctgtggagacgccggaacaagcccaaaag
gtggctcaagaactgcagaaacacgggatcccagccgttatccttaccttgggaggggca
gggctggtctgggcagatggggaagaaagtggccattggccagctcatcctgtggaagtg
gtggataccaccgctgccggagatgggttttgtggggccttagctgcttgtttggctgcc
gggggatccctgagggaagccctgcgttttgccaatgccgccgctgccttggttgtaacc
cgtgcaggagcccaacctagcttgccccaacgctctgagatcgaggcgtttttggcctct
gccgtagaaacagcatag

DBGET integrated database retrieval system