KEGG   Synechococcus sp. JA-2-3B'a(2-13): CYB_1390Help
Entry
CYB_1390          CDS       T00319                                 

Gene name
ispE
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
cyb  Synechococcus sp. JA-2-3B'a(2-13)
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:cyb00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1461829..1462764
Genome map
AA seq 311 aa AA seqDB search
MQACTLIARAKINLYLEILGSRPDGYSEVAMVLQSIHLADRLQLKSRPHGIHLTCDRPEV
PTDARNLAYQAAELLQKECHSAAGVEIHIEKHIPVAAGLAGGSADAAAVLVGLNQLWGLG
LTVGELQSLAARLGSDIPFCIQGGTQLATGRGEVLEPLADWEGIPVLLAKPKHLGVSTAW
AYQAFRSRREILGATAPSEPALPTLPQALAALSRQDPPALARSLRNDLEQVVLPEYAIVG
ELRQALLSAGALGSLMSGSGPTVFGIMPSLELAAQARDTLRRQFQDVEFWVTQFAPTGIL
LQPDPCSLSPS
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcctgtaccctgattgcccgcgccaagatcaacctctacctggaaatcctcggc
tcccgtcctgatgggtattcagaggtggcgatggtgttgcagagcattcatttggcggat
cgcctgcagttgaagagccgtcctcacgggatccacctcacctgcgatcgtccagaagtg
cccacagatgcccgcaaccttgcctatcaagccgctgagctgctgcaaaaagagtgtcac
tctgccgctggcgtggagattcacatcgaaaagcacattccggtggcagcaggtttggcg
gggggctcggctgatgcagcggcggttttggtggggttaaaccaactgtgggggctgggc
ctgacggtgggagagttgcagagtttggcagcccgtctgggatccgacattcccttctgt
atccaggggggaacgcaactggccaccgggcgcggggaagttttggagccgctggccgat
tgggaagggatccctgtgctgctggccaagcccaagcacctgggggtttcgactgcctgg
gcctatcaagcctttcgttctcgccgggagatcttgggagcgactgccccatctgaaccc
gcgctgcccaccttgccgcaggcgttggcggctctcagccgtcaggatccgccggcgtta
gccaggagtttgcgcaatgacttggaacaggtggttttgccggagtacgcgattgtaggg
gaactgcgccaagctcttctctcggcgggggcactgggatccctgatgtcggggtcgggg
ccaacggtcttcggaatcatgcccagcctggagctggccgcccaagcgcgcgacaccctg
cgtcgccagtttcaagatgtggagttttgggtgacgcagtttgcccccaccgggattctg
ctgcagccggatccctgtagcctcagccccagctag

DBGET integrated database retrieval system