KEGG   Synechococcus sp. JA-2-3B'a(2-13): CYB_1424Help
Entry
CYB_1424          CDS       T00319                                 

Gene name
hemG
Definition
(GenBank) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
cyb  Synechococcus sp. JA-2-3B'a(2-13)
Pathway
cyb00860  Porphyrin and chlorophyll metabolism
cyb01100  Metabolic pathways
cyb01110  Biosynthesis of secondary metabolites
Module
cyb_M00121  Heme biosynthesis, glutamate => heme
Brite
KEGG Orthology (KO) [BR:cyb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CYB_1424 (hemG)
Enzymes [BR:cyb01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     CYB_1424 (hemG)
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     CYB_1424 (hemG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO NAD_binding_9 FAD_binding_2 Pyr_redox_2
Motif
Other DBs
NCBI-ProteinID: ABD02391
CyanoBase: CYB_1424
CYORF: CYB_1424
UniProt: Q2JLL6
Position
complement(1493069..1494565)
Genome map
AA seq 498 aa AA seqDB search
MQAEVVVVGAGISGLTLALRLQQGLSPKDESTQPLLLAEASSRVGGCISTQSKDSYRWEE
GPNSFTPVPALLNLIAEVGLAEHLVLADAKLPRYIYWEKELLPVPLSPSAAIGSRLLSVG
GKLRALRGLLGFVAPPPGGEETVRQFFRRQLGSEVVERLVEPFTSGVYAGDPDQLSALAA
FPRIAGLEERYGSLFAGAVQALRSRYRYATLPRTRHQDSANSPIQPPPKRGQLGNLRQGL
QQLPEAIAQKLGSALRLGWRAVHLKRDETGYRVGFVIHDSGAEHTAPEEIHWVAAQQVVL
TLPAYAAATLLQDLNPQASRLLREIPYPPVAVVALAYPEEALPQPLRGFGHLIPRSQGLR
TLGTIWASSLFPERAPQGYHCLISFIGGATDAAFARQKGIPPITALSPDERAQIVHAELS
QILLTRPVEPIRLGERLWPQAIPQYTLGHRQRIAQLQASLADQTPGVWVCANYLDGVALG
DCVRRAEALAQQILSVRR
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
ttgcaggccgaggtggtggtggtgggggcgggcatcagcggcctaacgttggccttgcga
ttacaacagggcttatcccccaaggatgaatccacccagccgctgctcctggccgaggcc
agctcccgcgtggggggctgtatctccacccaatccaaagacagctatcgctgggaagag
ggccccaacagctttacccccgtccccgccctgcttaacctcattgccgaggtgggcttg
gcggagcacctggtgctggccgatgccaagctgccccgctacatctactgggaaaaagag
ctgctgccggtgcccctgagcccttctgcagccattggctcgcggctgttgagcgtgggc
ggcaagttgcgggccttacgtgggttgttggggtttgtcgcgccgccgccaggcggagag
gaaacggtgcggcaattcttccggcggcaactgggatccgaggtggtggaacggctggtc
gaacctttcacctcaggggtgtatgccggggatccggatcagctcagcgccttggcagcc
ttcccccgcattgccggcttggaagaacgctacggcagcctctttgccggtgctgtgcag
gctttgcgcagccgttatcgctacgcgacgctcccgcgaacccgtcaccaggacagcgcc
aactcccccatccagcctcctcccaagcggggccaactgggtaacctgcggcaggggttg
cagcagctacctgaggcgattgcccagaaactgggcagtgcgctgcggctgggctggcgg
gctgtgcatctcaagcgggatgagacgggctaccgggtgggcttcgtcatacacgacagc
ggcgcggagcacacggccccagaagaaatccactgggtggcggctcaacaggtggtgctc
accctccctgcctacgctgctgccaccctcctgcaggatctcaacccccaggccagccgg
ctgctgagggaaatcccctacccgcctgtggcggtggtggctttggcctatccagaagaa
gccctcccccaaccgctgcgagggtttggccatctgatccctcgctctcagggcctgcgc
accctgggcaccatctgggcctcctccctcttcccagagcgggctcctcagggctatcac
tgcctgatcagcttcatcgggggagctaccgatgcggcttttgcccgccagaaagggatc
ccgcccattacggcgctctcccctgacgagcgggcccaaattgtgcatgcagaactcagc
cagatcctgctcacccgccctgtcgaacccatccgcctgggagagcgcctgtggccccag
gctatcccgcaatatacgcttggccaccggcagcggattgcccaattgcaggccagcctg
gccgaccaaaccccaggggtgtgggtgtgtgccaactacctggatggcgtggccttggga
gattgtgtgcggcgggccgaggccctagcccagcagatcctgtccgtccggcgttag

DBGET integrated database retrieval system