KEGG   Synechococcus sp. JA-2-3B'a(2-13): CYB_1490Help
Entry
CYB_1490          CDS       T00319                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
cyb  Synechococcus sp. JA-2-3B'a(2-13)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cyb00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CYB_1490 (malQ)
Enzymes [BR:cyb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     CYB_1490 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1564556..1566151
Genome map
AA seq 531 aa AA seqDB search
MGRLSGILLHPTSLPGPFGIGDLGPSAYRFVDFLVESGQRLWQVLPLGPTGWGNSPYMSF
SSIAGNPLLISPELLVKAGWLEPDSWQDLPQWPTIQAGSAERVDYETVIPFKLGLLHRAW
ATFKEKASGPDWEAFQAYCAAEADWLPDYALFMALKDVYGEQEWNQWDPALVRRDPPALQ
EARDRYADAITEQMFWQYLFAQQWGSLREYAHRHQVQLIGDVPIYVAPNSADVWANRELF
HLDEQGRPLQVAGVPPDYFSPTGQRWGNPLYNWEVLKARGYDWWIKRMQAILKQVDCVRI
DHFRGFESYWAIPGDAETAVEGEWQKGPGADFFQALADKLGEIPVIAEDLGNITPEVLQL
RDQFGLPGMKVLLFAFGSGPDNPYLPHAYERNFVVYTGTHDNNTVVGWFHDPDRSEWEKQ
NLLRYLGCQGSGGIHWDLIRLALSSVADLAIIPLQDVMGLGAEARMNFPGTTENNWAWRY
REDMLRQDMIQRLAEMSVTYGRISPQELEQRRAALAQERAAGSSQAAPSLV
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgggcagactcagtgggatcctcctgcaccccacctcgctaccggggccatttggtatc
ggcgatctggggccatcggcttatcgctttgtggactttctggtggagagcggccaacgc
ctctggcaggttcttcctcttgggccgaccggctggggcaactccccctacatgagcttt
tcctccattgccggcaacccgctgctcatcagcccggagctgttggtaaaagccggctgg
ctagagcccgacagttggcaggacctgccccaatggccaacgatccaagccgggtctgcc
gagcgggtggactacgaaaccgtgatccccttcaagctgggcctgctgcaccgcgcctgg
gcaaccttcaaagaaaaagcttccggccccgattgggaagctttccaagcctattgtgct
gccgaagccgattggttgcccgactatgccctgttcatggccctcaaggatgtgtacggc
gagcaagagtggaaccaatgggatccggccttggtgcgacgggatccgccggctttgcaa
gaggctcgcgatcgctatgccgatgccattaccgagcagatgttttggcagtatctgttt
gcccagcagtggggatccctaagggagtatgctcatcggcatcaagtgcagctcatcggg
gatgtgcccatctacgttgcccccaacagtgccgacgtgtgggccaaccgggagctgttt
cacctggatgaacagggacggcctttacaagtagccggtgtgccgccggactatttcagc
cccaccgggcagcgctggggcaaccccctctacaactgggaagtgctcaaggcccgtggc
tacgactggtggatcaaacgcatgcaggccattctcaagcaagtggattgtgtgcgcatc
gaccactttcgcggcttcgagagctactgggccattccgggcgatgcggaaacggctgtg
gaaggggagtggcaaaaagggccgggagcagatttctttcaggccctggccgacaagttg
ggggaaatcccggtgattgccgaagatctgggaaacattacgccggaggtgttgcaactg
cgggatcaatttggcttgcccggcatgaaggtgttgctctttgccttcggctctgggccc
gataacccctatttgccccatgcctatgagcgcaactttgtcgtttacaccggcacccac
gacaacaacacggtggtgggctggtttcatgacccggatcgctcggagtgggaaaaacaa
aacctgctgcgctatttgggctgccagggatccgggggcatccattgggatctgatccgc
ttggccctttcttccgtagccgacctggccatcattcccctgcaggatgtgatggggctg
ggggcagaggcgcgcatgaacttccccggcaccaccgagaacaactgggcctggcgctac
cgcgaggacatgctgcggcaggacatgatccagcggctggccgagatgagcgtgacctat
gggcgcatctctcctcaagagttggagcaacggcgagcagccctagcccaagaacgggcg
gcagggtcttctcaagctgcccccagcctcgtctaa

DBGET integrated database retrieval system