KEGG   Synechococcus sp. JA-2-3B'a(2-13): CYB_1508Help
Entry
CYB_1508          CDS       T00319                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cyb  Synechococcus sp. JA-2-3B'a(2-13)
Pathway
cyb00260  Glycine, serine and threonine metabolism
cyb00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cyb01100  Metabolic pathways
cyb01110  Biosynthesis of secondary metabolites
cyb01130  Biosynthesis of antibiotics
cyb01230  Biosynthesis of amino acids
Module
cyb_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cyb00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CYB_1508 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CYB_1508 (trpB)
Enzymes [BR:cyb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CYB_1508 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP DUF1971
Motif
Other DBs
NCBI-ProteinID: ABD02474
CyanoBase: CYB_1508
CYORF: CYB_1508
UniProt: Q2JLD7
Position
1580596..1581873
Genome map
AA seq 425 aa AA seqDB search
MTSASFAFSPRVLDPLDPQVRPDPQGRFGPFGGRFVPETLMSALTELEEAFEHHWRDPDF
RAEFHNLLRDFVGRPSPLYFAQRLTEYYGGPQIYLKREDLNHTGAHKINNALGQVLLAVR
MGKRRIIAETGAGQHGVATATVCARFGLECVIYMGALDMERQAPNVQRMRLLGAEVRGVE
SGTRTLKDALSEAIRDWVTNVETTHYVIGTVAGPHPYPKLVRAFHDVIGQETRQQCQEKW
GGLPDVLLACVGGGSNALGLFNEFVRDPQVRLIGIEAAGEGLHTPRHAATLNRGRIGVLH
GAMSYLLQDEEGQVQEAHSISAGLDYPGVGPEHSYLKEIGRAEYYAVTDDEAVEALLLLS
RLEGIIPALETAHALAYLKTLAPQQGLRPANAIGPQQRVVVNCSGRGDKDLNTVFKYLQQ
RGRSF
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgacctcagcttcttttgctttttcccctcgtgttttggatccccttgacccgcaggtg
cgtccggatccccaggggcggtttgggccgtttgggggtcggtttgtgccggaaaccctg
atgagcgccctaacggagctggaggaagcctttgagcatcactggcgggatcccgacttt
cgcgccgagtttcacaacctgttgcgggattttgttgggcggcccagccccctctacttt
gcccagcggctaaccgaatactacggcggcccgcagatctatctcaaacgggaagatctc
aaccacaccggcgcccacaagatcaacaacgcccttggccaagtgctgctggcggtgcgc
atgggcaagcggcggatcattgccgagactggcgccggccaacatggggtggccacggca
accgtgtgcgcccgctttggcctagaatgcgtcatctacatgggggcgctggatatggag
cggcaggcccccaatgtgcagcggatgcgccttttgggcgctgaggtgcggggagtggaa
tcgggcacgcgcaccctcaaagacgccctctccgaggccatccgcgactgggtaaccaac
gtggagaccacccactacgtcatcggcacggtggcggggccccacccttacccgaagctg
gtgcgggcctttcacgatgtcattggccaggagacgcggcagcagtgccaggaaaaatgg
ggagggctgccggatgtgttgctggcctgtgtggggggtggatccaatgcgctggggctg
ttcaacgagtttgtccgggatccccaggtgcggctgatcggcatcgaagctgccggagaa
gggctgcacacgccccgccacgccgctaccctcaaccgcggtcgcatcggggtcttgcac
ggggcgatgagctacctgctgcaggatgaagaaggtcaggttcaggaggcccactccatc
agcgctggcttggattatcctggcgtggggccagagcacagctacctaaaagaaatcggg
cgggccgagtactacgcggttactgacgacgaagcggtggaagcgctgctgctgctgtcg
cgcctggaagggatcatccccgcgctggagacggcccatgcgctggcctacctgaaaact
ttggccccacagcaaggactccgtcccgctaacgcgatcggccctcagcagcgggtggtg
gtcaactgttctgggcgcggcgacaaggatctaaacaccgttttcaagtatttgcagcag
cggggacgtagcttttag

DBGET integrated database retrieval system