KEGG   Synechococcus sp. JA-2-3B'a(2-13): CYB_1563Help
Entry
CYB_1563          CDS       T00319                                 

Gene name
est
Definition
carboxylesterase (EC:3.1.1.1)
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
cyb  Synechococcus sp. JA-2-3B'a(2-13)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1637235..1638041)
Genome map
AA seq 268 aa AA seqDB search
MLSNEPFLWRGAGEHACLLLHGLGGGVYELQWLAERLLAAGLTVQGFNYPGHDSAPHRLH
DRRSAHMPPSRWTEWYGRALEHYLALQQEYPRVSLVGFSTGCLLALHLAFAHPIHKLVLL
APFFAIRHRWYYLFRPEQYLNSLGWLLKEVPRLSLPIRDGDARALAERTAYFRSFNLSAV
RSALELIERVKGEVASIRVPTLILQSRQDMVVDPDQAMWLYQELGSEEKILSWLEHSDHI
LTLDCERETVFDQVCAFLNQDPSAPGSA
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgttgagtaacgaaccctttttgtggcgaggagcaggggaacacgcctgtctgctgcta
catggattggggggcggtgtttacgagttgcaatggctggcagagcggctgttggcggct
ggcctgacggtgcagggatttaactatcccggccatgacagtgctccgcatcgcttacac
gaccgccggtctgcccacatgcccccttcccgctggacggagtggtacgggcgggctttg
gagcattatctggctttgcagcaggagtacccgcgcgtttccttggtgggcttttccacc
ggctgtctgctggctttgcacctggcttttgcccatcccatccataaattggtgctgctg
gcgccatttttcgccattcgccaccgctggtactatctttttcgccctgagcagtacctg
aacagcctgggttggctattgaaggaggtgccccgcctcagcttgccgattcgggatggg
gacgctcgagccttggcagaaagaacggcctatttccgcagctttaatctgtcggcggtg
cgcagcgctctggagctgatcgagcgggtcaagggggaagtggccagcatccgggttccc
accctgatcctgcaatcccgccaagatatggtggtggaccccgaccaggcaatgtggctc
tatcaagagctgggatccgaggagaagatcttgtcttggctggagcactccgaccacatc
ctcactttggactgcgagcgggaaacggtgtttgaccaggtttgcgccttcctcaaccag
gatccttctgcgcccggatcagcgtaa

DBGET integrated database retrieval system