KEGG   Synechococcus sp. JA-2-3B'a(2-13): CYB_1704Help
Entry
CYB_1704          CDS       T00319                                 

Gene name
gap-2
Definition
(GenBank) glyceraldehyde-3-phosphate dehydrogenase, type I
  KO
K00150  
glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
cyb  Synechococcus sp. JA-2-3B'a(2-13)
Pathway
Glycolysis / Gluconeogenesis
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:cyb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CYB_1704 (gap-2)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    CYB_1704 (gap-2)
Enzymes [BR:cyb01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     CYB_1704 (gap-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1788665..1789684
Genome map
AA seq 339 aa AA seqDB search
MVRVAINGFGRIGRNFLRCWLGRSQSNLDIVAINDTSDARTAAHLLKYDSILGPLQGADV
EPAENGLVVNGKHIYAVSDRNPSNLPWKEWKVDLVIEATGVFVDYQGASKHIEAGAKKVV
ITAPAKGGDIPTFVYGVNQHTYDPVRHNIVSNASCTTNCLAPIIKVLLDKFGVLRATMTT
THSYTGDQRILDGGHRDLRRARAAALSMVPTTTGAAKAVALVIPELKGKLNGVAVRVPTP
NVSLVDLVVQTERRVIAEEVNAALKEASETTMKGIIAYSDIPLVSIDYRGHDCSAIVDAE
MTSVLDGDLVKVMAWYDNEWGYSQRVLDLAEYMAAHWVE
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
gtggttagggtagccatcaacgggtttggtcgcattggtcgcaactttttgcgctgttgg
ctgggtcgctcccagtccaacctggacattgttgccatcaacgacacctcagatgctcgc
acggctgcccacctgctcaagtacgattccatccttgggccgttgcagggagcagacgtt
gagcctgcagaaaacggtttggtggtgaacggcaagcatatctatgccgtttccgaccgc
aaccccagcaacctgccctggaaagagtggaaggtggatcttgttattgaagctacaggt
gtttttgtcgactaccagggtgcctctaagcacatagaagcgggggccaaaaaggtggtg
atcaccgccccggccaaggggggagacattcccacgtttgtctacggtgttaatcaacac
acctacgacccggtgcggcacaacattgtcagcaacgccagctgcaccaccaactgcctt
gccccgatcatcaaggtgttgctggacaagttcggcgtcctccgtgccaccatgaccacc
acccacagttacaccggcgaccagcggatcttagatggtggtcaccgcgatctgcggcgg
gcccgggcagcagcattgagcatggtgcccaccaccacgggggctgccaaggcggtggct
ttggtgatcccggagctgaaaggcaagctgaatggggtggcggtacgggttcccacgccc
aatgtgtctctggtggacttggtggtgcaaacagagcggcgcgtgattgccgaggaggta
aacgctgccctgaaggaagcctcggaaaccacgatgaaagggatcatcgcctactcggat
attcccttggtctccatcgactaccgcggccacgactgctcggccattgtggatgcggag
atgaccagtgtgctggatggggatctggtcaaggtcatggcttggtacgacaacgagtgg
ggctactcccagcgggtgttggacttggcggaatacatggccgctcactgggtggagtag

DBGET integrated database retrieval system