KEGG   Synechococcus sp. JA-2-3B'a(2-13): CYB_1704Help
Entry
CYB_1704          CDS       T00319                                 

Gene name
gap-2
Definition
glyceraldehyde-3-phosphate dehydrogenase, type I (EC:1.2.1.-)
Orthology
K00150  
glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
cyb  Synechococcus sp. JA-2-3B'a(2-13)
Pathway
Glycolysis / Gluconeogenesis
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:cyb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CYB_1704 (gap-2)
   01230 Biosynthesis of amino acids
    CYB_1704 (gap-2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CYB_1704 (gap-2)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    CYB_1704 (gap-2)
Enzymes [BR:cyb01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     CYB_1704 (gap-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1788665..1789684
Genome map
AA seq 339 aa AA seqDB search
MVRVAINGFGRIGRNFLRCWLGRSQSNLDIVAINDTSDARTAAHLLKYDSILGPLQGADV
EPAENGLVVNGKHIYAVSDRNPSNLPWKEWKVDLVIEATGVFVDYQGASKHIEAGAKKVV
ITAPAKGGDIPTFVYGVNQHTYDPVRHNIVSNASCTTNCLAPIIKVLLDKFGVLRATMTT
THSYTGDQRILDGGHRDLRRARAAALSMVPTTTGAAKAVALVIPELKGKLNGVAVRVPTP
NVSLVDLVVQTERRVIAEEVNAALKEASETTMKGIIAYSDIPLVSIDYRGHDCSAIVDAE
MTSVLDGDLVKVMAWYDNEWGYSQRVLDLAEYMAAHWVE
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
gtggttagggtagccatcaacgggtttggtcgcattggtcgcaactttttgcgctgttgg
ctgggtcgctcccagtccaacctggacattgttgccatcaacgacacctcagatgctcgc
acggctgcccacctgctcaagtacgattccatccttgggccgttgcagggagcagacgtt
gagcctgcagaaaacggtttggtggtgaacggcaagcatatctatgccgtttccgaccgc
aaccccagcaacctgccctggaaagagtggaaggtggatcttgttattgaagctacaggt
gtttttgtcgactaccagggtgcctctaagcacatagaagcgggggccaaaaaggtggtg
atcaccgccccggccaaggggggagacattcccacgtttgtctacggtgttaatcaacac
acctacgacccggtgcggcacaacattgtcagcaacgccagctgcaccaccaactgcctt
gccccgatcatcaaggtgttgctggacaagttcggcgtcctccgtgccaccatgaccacc
acccacagttacaccggcgaccagcggatcttagatggtggtcaccgcgatctgcggcgg
gcccgggcagcagcattgagcatggtgcccaccaccacgggggctgccaaggcggtggct
ttggtgatcccggagctgaaaggcaagctgaatggggtggcggtacgggttcccacgccc
aatgtgtctctggtggacttggtggtgcaaacagagcggcgcgtgattgccgaggaggta
aacgctgccctgaaggaagcctcggaaaccacgatgaaagggatcatcgcctactcggat
attcccttggtctccatcgactaccgcggccacgactgctcggccattgtggatgcggag
atgaccagtgtgctggatggggatctggtcaaggtcatggcttggtacgacaacgagtgg
ggctactcccagcgggtgttggacttggcggaatacatggccgctcactgggtggagtag

DBGET integrated database retrieval system