KEGG   Synechococcus sp. JA-2-3B'a(2-13): CYB_1744Help
Entry
CYB_1744          CDS       T00319                                 

Gene name
speB
Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
cyb  Synechococcus sp. JA-2-3B'a(2-13)
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:cyb00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1827309..1828232
Genome map
AA seq 307 aa AA seqDB search
MQAIMYRSPFPFLGLPEPDPEMAQAILLPVPYEATTSYGKGTAKGPQALLQASAYVEIYD
EVRDRQPALHPDFSEEISRYWTAPPVELEGLGSSAQELAMAEIQRRAAEWVRPGRFLLSI
GGEHSISGPLIAAHLAHYPELHVLQIDAHCDLRDSYEGSRYSHASAMARVVEQVGSRLTQ
VGIRSICAEDRQAIRERRLHTFFAHSLHTKPAQEWIPEVIATLGPQVYLTVDVDGLDPAV
VPATGTPEPGGLGWWETVELIRALGQQRQIVGADVVELSVTGERETDRRSAFTVAKLAYQ
ILAAALG
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
ttgcaagccatcatgtatcgctctcccttccccttcctgggcctgcctgagccggatccg
gagatggcccaagcaattctcctgcccgtcccctacgaggccaccacctcctatggcaaa
ggcaccgccaaaggccctcaggcgctgttgcaggcttctgcctatgtggagatctacgac
gaggtacgggatcgccagccagctcttcaccccgacttctcggaagagatctcccgctac
tggacggcccccccggtggagttggaaggtctgggatcttccgcccaggagctggctatg
gccgaaatccagcgtcgcgctgccgagtgggtgagaccggggcggttcctgctttccatt
ggtggggagcactccatcagcgggcccctgattgctgcccacctggcccattatccggag
ctgcacgtcctgcaaatcgatgcccactgcgacctgagagatagctacgagggatcccgc
tattcccatgcttctgccatggcccgcgtggtggagcaagtgggcagccgcctcacccaa
gtggggatccgctccatctgcgccgaagaccgccaggccattcgcgagcgccgtctgcac
accttttttgcccacagcttgcacaccaagccagcccaggagtggatcccagaggtgatc
gccaccttgggcccccaggtttacctgacggtggatgtggatgggctggatcccgctgtg
gtgccggccaccggtacccccgaacccggcggcttgggctggtgggagacggtggagctg
atccgggcgctaggacagcaacggcaaattgtcggcgccgatgtggtcgagctgtcggtc
acgggggaacgggaaaccgatcgccgcagcgccttcacggtcgccaaactggcctatcag
atcttggctgcggccttgggttaa

DBGET integrated database retrieval system