KEGG   Synechococcus sp. JA-2-3B'a(2-13): CYB_1978Help
Entry
CYB_1978          CDS       T00319                                 

Gene name
glgB
Definition
glycogen branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
cyb  Synechococcus sp. JA-2-3B'a(2-13)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:cyb00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CYB_1978 (glgB)
Enzymes [BR:cyb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     CYB_1978 (glgB)
Exosome [BR:cyb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CYB_1978 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
2076486..2078777
Genome map
AA seq 763 aa AA seqDB search
MGFLLSAEQVGQFVSNQWQDPYAVLGPQQIEEAGKSFGLVRALVPNARQVWLVERATGQA
YPMQPLHPETLFELRFEPGTPLPDYFLRAQRVWDPQGEHLEEWEDPYRFPLEKVNHIGEL
DRYLFNEGNHHRIYDKLGAHLITVDGVKGVHFAVWAPNARNVSVIGDFNHWDGRQHQMKR
LGESGIWAVFIPGIGPGAIYKYEVKTSWGDIYEKSDPYGFQQEVRPKTGSIVADLNTYTW
HDQAWLEKRAATDPLRSPISVYEVHLGSWMHASAEDPPAEGQSVLVDQKPNTRFLTYREL
ADKLIPYVKELGFTHIELLPVAEHPFDGSWGYQVIGYYAVTSRYGSPQDFMYFVDRAHQA
GIGVIVDWVPGHFPKDGHGLAFFDGTHLYEYADPRKGEHKGWGTLVFNYGRNEVRNYLVA
NALFWFEKYHIDGIRVDAVASMLYLDYDRKEWIPNPYGGREHLEAIDFFRQLNTLIFKYN
PGALSIAEESTAWPMVTWPTHVGGLGFNLKWNMGWMHDMLDYFHMDPWFRQFHPHLVTFS
LMYAFSENYMLAFSHDEVVHGKSHMLGKMPGDHWHKFASLRALYGYMFTHPGKKTLFMSM
EFGQWNEWNVWADLDWELLQYEPHAKLRHYVASLNHLLRSEPALYTQDTKPEGFRWIDCS
DHRGIVSFIRYGEDPSEWVVVVCNFTPVVWPNYRIGVPERGFYRELLNSDAVEFWGSGVG
NLGGKWTDDWAYHNLPYSLELCLPQLSTLVLKWQPPQPVESQN
NT seq 2292 nt NT seq  +upstreamnt  +downstreamnt
atgggctttctcctgtctgctgaacaagtgggtcagtttgtttccaaccaatggcaggat
ccctatgccgttttgggcccccagcagatagaagaggccgggaaatcctttgggttggtg
cgcgcccttgtgcccaatgctcggcaggtttggctggtggaacgcgccactggacaggct
tacccgatgcagccgctgcacccggaaacgctattcgagctgcgctttgagccgggaacc
cctctgccggactattttttgcgggcccaacgggtctgggatccccaaggggaacacttg
gaagaatgggaggatccctaccgctttcccttggagaaggtcaaccacattggcgagctg
gatcgctacttgttcaacgaggggaatcaccaccgcatttacgacaagctgggcgcccat
ctcatcacggtggatggggtgaagggggtgcatttcgccgtctgggctcccaacgcccgc
aacgtcagcgttatcggcgattttaaccactgggacgggcgtcaacaccagatgaagcgg
ctgggcgaaagcggcatctgggcggtgttcatccccggcatagggccaggcgccatctac
aagtacgaggtgaaaacttcctggggggatatctacgaaaaatcggatccctatggcttt
caacaggaggtgcgccccaaaaccggctccatcgtagccgacctcaacacctacacctgg
cacgaccaagcctggctggaaaaacgcgccgccaccgatcccctgcgctcgccgatttcg
gtttatgaggtgcatctgggatcctggatgcacgcctcggctgaagatccacctgccgaa
gggcaaagtgtgctggtggaccaaaagcccaacactcgcttcctcacctaccgcgagctg
gcggacaaattgatcccctatgtgaaggagctgggctttacccacatcgagctgttgccg
gtggcagaacaccccttcgatggctcttggggctatcaagtgattggctactatgccgta
acatcccgctatggatccccgcaagactttatgtattttgtcgatcgggctcaccaagcc
gggatcggcgtgattgtcgattgggtgcccgggcatttccccaaagatgggcatgggctg
gcttttttcgacggtactcacctgtacgagtacgccgaccctcgcaaaggcgagcacaaa
ggttggggcactttggtctttaattatggccgcaacgaggtgcgcaattatctggtggcc
aatgcccttttttggttcgagaaataccacatcgatgggatccgggtggacgcggtggcc
tcgatgctttatctggattatgaccgcaaagagtggatccccaatccctacggcgggcgg
gaacacctcgaagccatcgactttttccggcagctcaataccctcattttcaaatacaac
cccggtgcgctttccattgccgaagaatctactgcttggccgatggtaacttggccaacc
catgtgggtgggctgggcttcaacttgaagtggaacatgggttggatgcacgacatgttg
gattatttccacatggatccctggttccgccagttccatccccatttggtcaccttcagc
ctcatgtatgccttcagcgaaaattacatgctggccttttctcatgatgaggtggtgcat
ggcaagagccacatgttgggcaaaatgccgggggatcattggcataagttcgccagtctg
cgggctttgtatggctacatgttcacccaccctggcaagaaaaccttgttcatgagcatg
gagtttggccagtggaatgagtggaatgtttgggcagatctggactgggagctgctgcag
tatgaaccccacgccaagttgcgccactacgtggccagcctgaatcacctgttgcgctct
gagcctgccctgtatacccaagacaccaaaccggaggggttccgctggatcgactgcagc
gatcatcgcggcatcgtttccttcatccgctatggggaggatcccagtgagtgggtggtg
gtggtttgtaacttcacgccggtggtctggcccaattaccgcattggggtaccggaacga
ggtttttatcgagagctgctcaacagcgatgctgtggagttttggggcagcggggtaggc
aatttggggggcaagtggacagacgactgggcctaccacaacttgccctactccctcgag
ctctgcctgccgcaactttctaccttggtgctgaaatggcagccgccgcagccggtcgag
tcccagaattga

DBGET integrated database retrieval system