KEGG   Synechococcus sp. JA-2-3B'a(2-13): CYB_2157Help
Entry
CYB_2157          CDS       T00319                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cyb  Synechococcus sp. JA-2-3B'a(2-13)
Pathway
cyb00010  Glycolysis / Gluconeogenesis
cyb00051  Fructose and mannose metabolism
cyb00562  Inositol phosphate metabolism
cyb00710  Carbon fixation in photosynthetic organisms
cyb01100  Metabolic pathways
cyb01110  Biosynthesis of secondary metabolites
cyb01120  Microbial metabolism in diverse environments
cyb01130  Biosynthesis of antibiotics
cyb01200  Carbon metabolism
cyb01230  Biosynthesis of amino acids
Module
cyb_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cyb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CYB_2157 (tpiA)
   00051 Fructose and mannose metabolism
    CYB_2157 (tpiA)
   00562 Inositol phosphate metabolism
    CYB_2157 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    CYB_2157 (tpiA)
Enzymes [BR:cyb01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CYB_2157 (tpiA)
Exosome [BR:cyb04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CYB_2157 (tpiA)
  Exosomal proteins of bladder cancer cells
   CYB_2157 (tpiA)
  Exosomal proteins of melanoma cells
   CYB_2157 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ABD03103
CyanoBase: CYB_2157
CYORF: CYB_2157
UniProt: Q2JJQ9
Position
2256715..2257467
Genome map
AA seq 250 aa AA seqDB search
MRPILIAGNWKMHKTQAEAREFLRELGLALRSSPSGSASQRQIILCVPFTDLAVVAEQSR
GSDIAVGAQNLHWEDQGAFTGEISGPMLAELGVRYVIVGHSERRQYFGETDETVNRRLAA
AQRHGLTPILCVGESQQQREQGLTESWIVGQLDRALQGIDLENLVIAYEPIWAIGTGQTC
AAQEANRVIGLIRQHLGNAQLPILYGGSVKAGNIDELMAQPEIDGVLVGGASLDPQEFAR
IVNFQALAPA
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
ttgcgccccatcctcattgccggcaactggaaaatgcacaagactcaggctgaggctcgc
gagtttctgcgagagttgggcctggctttacggtcatcgccgtcagggtcagcatcccag
cggcagattatcttgtgtgtgccctttacagacctggcggtggtggcagagcaaagccgc
ggatccgacatagccgtgggagcacaaaacctacattgggaggatcagggagcttttacc
ggggaaatttccggccccatgctggcggaattgggggtgcgctatgtcatcgtcggccac
agcgaacggcggcagtacttcggcgagacggacgaaaccgtcaatcggcgtctggcagcc
gcccagcggcacggccttacccccatcctctgtgtgggagaaagccagcagcagcgggag
caaggcttgaccgagtcttggattgtggggcagttggatcgcgccttgcaagggatcgat
ctggagaacttggtgattgcctatgagccaatttgggccatcggcaccggccagacttgt
gcagctcaagaggccaaccgggtcatcggcttgatccggcaacacctgggcaatgcccaa
ctgcccattttgtatggcggctcggtgaaggccggcaacatcgatgagctgatggcccag
cctgagatcgacggcgtgttggtgggaggggccagcctagacccccaagagtttgcccgc
atcgtcaactttcaggccctagctcccgcctag

DBGET integrated database retrieval system