KEGG   Synechococcus sp. JA-2-3B'a(2-13): CYB_2157Help
Entry
CYB_2157          CDS       T00319                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cyb  Synechococcus sp. JA-2-3B'a(2-13)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cyb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CYB_2157 (tpiA)
   01230 Biosynthesis of amino acids
    CYB_2157 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CYB_2157 (tpiA)
   00051 Fructose and mannose metabolism
    CYB_2157 (tpiA)
   00562 Inositol phosphate metabolism
    CYB_2157 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    CYB_2157 (tpiA)
Enzymes [BR:cyb01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CYB_2157 (tpiA)
Exosome [BR:cyb04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CYB_2157 (tpiA)
  Exosomal proteins of bladder cancer cells
   CYB_2157 (tpiA)
  Exosomal proteins of melanoma cells
   CYB_2157 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
2256715..2257467
Genome map
AA seq 250 aa AA seqDB search
MRPILIAGNWKMHKTQAEAREFLRELGLALRSSPSGSASQRQIILCVPFTDLAVVAEQSR
GSDIAVGAQNLHWEDQGAFTGEISGPMLAELGVRYVIVGHSERRQYFGETDETVNRRLAA
AQRHGLTPILCVGESQQQREQGLTESWIVGQLDRALQGIDLENLVIAYEPIWAIGTGQTC
AAQEANRVIGLIRQHLGNAQLPILYGGSVKAGNIDELMAQPEIDGVLVGGASLDPQEFAR
IVNFQALAPA
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
ttgcgccccatcctcattgccggcaactggaaaatgcacaagactcaggctgaggctcgc
gagtttctgcgagagttgggcctggctttacggtcatcgccgtcagggtcagcatcccag
cggcagattatcttgtgtgtgccctttacagacctggcggtggtggcagagcaaagccgc
ggatccgacatagccgtgggagcacaaaacctacattgggaggatcagggagcttttacc
ggggaaatttccggccccatgctggcggaattgggggtgcgctatgtcatcgtcggccac
agcgaacggcggcagtacttcggcgagacggacgaaaccgtcaatcggcgtctggcagcc
gcccagcggcacggccttacccccatcctctgtgtgggagaaagccagcagcagcgggag
caaggcttgaccgagtcttggattgtggggcagttggatcgcgccttgcaagggatcgat
ctggagaacttggtgattgcctatgagccaatttgggccatcggcaccggccagacttgt
gcagctcaagaggccaaccgggtcatcggcttgatccggcaacacctgggcaatgcccaa
ctgcccattttgtatggcggctcggtgaaggccggcaacatcgatgagctgatggcccag
cctgagatcgacggcgtgttggtgggaggggccagcctagacccccaagagtttgcccgc
atcgtcaactttcaggccctagctcccgcctag

DBGET integrated database retrieval system