KEGG   Synechococcus sp. JA-2-3B'a(2-13): CYB_2184Help
Entry
CYB_2184          CDS       T00319                                 

Gene name
pcm
Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
cyb  Synechococcus sp. JA-2-3B'a(2-13)
Brite
Enzymes [BR:cyb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     CYB_2184 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
2289333..2290067
Genome map
AA seq 244 aa AA seqDB search
MINPFSSFRWRHSSRSPAGIPEVEPQPPDASDPFASQREQMVKKQLIKRGIRDPRVLEAM
GKVPRHLFVPSDLRDRAYRDCPLPIGYGQTISQPYIVAFMTEAARLTPESVVLEIGTGSG
YQAAVLAELARQVYSLERLSPLAAQAQQTLAALGYRNVEVRQGDGYQGWPEHAPYDAILV
TAAPPTVPMVLLDQLAVGGTLVVPVGESPSDSGAQGSQSLLILCKTAQGWVQKGAFPVQF
VPMV
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
gtgatcaacccattctcatccttccggtggagacattcttctcgctctccagctgggatc
ccagaagttgaacctcagcccccagacgcttccgatccttttgcttcccaacgggagcag
atggtcaagaaacagctcatcaaacgagggatccgagatccacgggtactggaagccatg
ggaaaagtgccgcgtcacctttttgtcccctctgatctgcgggatcgggcctacagggat
tgccctctgcccatcggctatggccagaccatttctcagccctatattgttgcttttatg
acagaagctgctcgcctcacgcctgaatcggtggtgttggaaatcggcaccggctccggc
tatcaggcggctgttttggcagagctggcccggcaagtgtatagcctggagcgtctgtcc
ccattggctgctcaagctcaacaaaccctcgctgccctgggctatcgcaacgtggaagtg
cgtcagggggatggctaccaaggttggccagagcatgctccctacgatgccattctggtg
acggcagcgcccccaactgtgcccatggtgctgctggatcaactggcggtggggggcacc
ttggtggtgccggtgggagaaagcccttcggactccggtgcccagggatcccagtccttg
ctgatcctctgcaaaacagcccaaggatgggttcaaaaaggggcttttccagtgcagttt
gtgcccatggtctag

DBGET integrated database retrieval system