KEGG   Synechococcus sp. JA-2-3B'a(2-13): CYB_2199Help
Entry
CYB_2199          CDS       T00319                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cyb  Synechococcus sp. JA-2-3B'a(2-13)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cyb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CYB_2199
   01230 Biosynthesis of amino acids
    CYB_2199
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CYB_2199
   00030 Pentose phosphate pathway
    CYB_2199
   00051 Fructose and mannose metabolism
    CYB_2199
   00052 Galactose metabolism
    CYB_2199
  Energy metabolism
   00680 Methane metabolism
    CYB_2199
Enzymes [BR:cyb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CYB_2199
Protein phosphatases and associated proteins [BR:cyb01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CYB_2199
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
CyanoBase: 
CYORF: 
UniProt: 
Position
2305535..2306647
Genome map
AA seq 370 aa AA seqDB search
MPKRKRIGILTSGGDCGGLNAVIRAVVRRARDYDMEVYGIKDATAGLMARPVEAELLDVK
RVSGILRYGGTILGTVNKGNPFAYPMPDGSLVDRSAEVITGYHRLGLDALIGVGGDGSLA
ILRQLALQGDWNFVGIPKTIDNDVGATEYSVGFNTALSVAVEALDQLTYTAISHSRVMVM
EVMGRDAGHIAISAGIAGGAHVILIPEIPYKLENVCKRIRDRKERGNNFSIVVVAEAVRT
ESGEPVTYTNSLGQSLYGGIGHYISNEIALRTGIETRVMVLGHLQRGGTPSPLDRLLGAA
FGVAAVDLIAQGKYDRMVAWQNRRVVDVPLAEAISQYRRVEVDGALIATAIGLNTYVGEV
DPQLLRSISP
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgcccaaacgtaagcgaatcgggatcctcaccagcggcggcgattgtggcggcctcaac
gccgtgattcgagcggtggtgcggcgggcccgcgactacgacatggaagtttatggcatc
aaagatgcgacggcagggctcatggctcgaccggtggaggcggagctgctggatgtgaag
cgggtttccggcattttgcgctacggcggcaccatcttgggtaccgtgaacaaaggcaac
cccttcgcctaccctatgcccgatggcagcttggtggatcgctcggcagaggtgatcacc
ggctaccaccggcttgggttggatgcgctgatcggggtggggggggatggcagcttggcc
attctccggcaactggccctgcagggggattggaactttgtcgggatccccaagaccatc
gacaacgatgtcggtgccaccgagtattcggtggggttcaacacagctctgagcgtggct
gtggaagctctagatcagctcacctacacggccatcagccacagccgagtcatggtcatg
gaagtcatggggcgggatgccggtcacattgccatcagcgccggcattgccgggggggcg
catgtgattttgatcccggaaattccctacaagctggagaatgtctgcaaaagaatccgc
gaccgcaaagagcggggcaataacttcagcatcgtggtggtggcggaggcagttcgcacc
gagtcgggggagccggtgacctacaccaacagcctggggcagtctctctacggcggcatc
ggccattacatcagcaatgagatcgccctgcgcaccggcatcgaaacccgggttatggtt
ttgggccacctgcagcggggaggtacgccttctcctctggatcgcctgctgggagcagcc
tttggggtggctgctgtggacttgatcgcccaaggcaaatacgaccgcatggtggcctgg
caaaatcggcgggtggtggatgtgcccctggcagaggccatctcccagtatcggcgggtg
gaggtggacggggctttgatcgccacggccattgggctgaatacctacgtgggcgaggtg
gatccccagcttttgcgcagcatttccccctga

DBGET integrated database retrieval system