KEGG   Synechococcus sp. JA-2-3B'a(2-13): CYB_2199Help
Entry
CYB_2199          CDS       T00319                                 

Definition
(GenBank) phosphofructokinase
  KO
K21071  
ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
cyb  Synechococcus sp. JA-2-3B'a(2-13)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cyb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CYB_2199
   00030 Pentose phosphate pathway
    CYB_2199
   00051 Fructose and mannose metabolism
    CYB_2199
   00052 Galactose metabolism
    CYB_2199
  Energy metabolism
   00680 Methane metabolism
    CYB_2199
Enzymes [BR:cyb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CYB_2199
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     CYB_2199
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
2305535..2306647
Genome map
AA seq 370 aa AA seqDB search
MPKRKRIGILTSGGDCGGLNAVIRAVVRRARDYDMEVYGIKDATAGLMARPVEAELLDVK
RVSGILRYGGTILGTVNKGNPFAYPMPDGSLVDRSAEVITGYHRLGLDALIGVGGDGSLA
ILRQLALQGDWNFVGIPKTIDNDVGATEYSVGFNTALSVAVEALDQLTYTAISHSRVMVM
EVMGRDAGHIAISAGIAGGAHVILIPEIPYKLENVCKRIRDRKERGNNFSIVVVAEAVRT
ESGEPVTYTNSLGQSLYGGIGHYISNEIALRTGIETRVMVLGHLQRGGTPSPLDRLLGAA
FGVAAVDLIAQGKYDRMVAWQNRRVVDVPLAEAISQYRRVEVDGALIATAIGLNTYVGEV
DPQLLRSISP
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgcccaaacgtaagcgaatcgggatcctcaccagcggcggcgattgtggcggcctcaac
gccgtgattcgagcggtggtgcggcgggcccgcgactacgacatggaagtttatggcatc
aaagatgcgacggcagggctcatggctcgaccggtggaggcggagctgctggatgtgaag
cgggtttccggcattttgcgctacggcggcaccatcttgggtaccgtgaacaaaggcaac
cccttcgcctaccctatgcccgatggcagcttggtggatcgctcggcagaggtgatcacc
ggctaccaccggcttgggttggatgcgctgatcggggtggggggggatggcagcttggcc
attctccggcaactggccctgcagggggattggaactttgtcgggatccccaagaccatc
gacaacgatgtcggtgccaccgagtattcggtggggttcaacacagctctgagcgtggct
gtggaagctctagatcagctcacctacacggccatcagccacagccgagtcatggtcatg
gaagtcatggggcgggatgccggtcacattgccatcagcgccggcattgccgggggggcg
catgtgattttgatcccggaaattccctacaagctggagaatgtctgcaaaagaatccgc
gaccgcaaagagcggggcaataacttcagcatcgtggtggtggcggaggcagttcgcacc
gagtcgggggagccggtgacctacaccaacagcctggggcagtctctctacggcggcatc
ggccattacatcagcaatgagatcgccctgcgcaccggcatcgaaacccgggttatggtt
ttgggccacctgcagcggggaggtacgccttctcctctggatcgcctgctgggagcagcc
tttggggtggctgctgtggacttgatcgcccaaggcaaatacgaccgcatggtggcctgg
caaaatcggcgggtggtggatgtgcccctggcagaggccatctcccagtatcggcgggtg
gaggtggacggggctttgatcgccacggccattgggctgaatacctacgtgggcgaggtg
gatccccagcttttgcgcagcatttccccctga

DBGET integrated database retrieval system