KEGG   Synechococcus sp. JA-2-3B'a(2-13): CYB_2252Help
Entry
CYB_2252          CDS       T00319                                 

Definition
(GenBank) arginase family protein
  KO
K01480  agmatinase [EC:3.5.3.11]
Organism
cyb  Synechococcus sp. JA-2-3B'a(2-13)
Pathway
cyb00330  Arginine and proline metabolism
cyb01100  Metabolic pathways
Module
cyb_M00133  Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:cyb00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    CYB_2252
Enzymes [BR:cyb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     CYB_2252
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: ABD03193
CyanoBase: CYB_2252
CYORF: CYB_2252
UniProt: Q2JJH4
Position
complement(2355470..2356333)
Genome map
AA seq 287 aa AA seqDB search
MAQWSLHPSSQSNARVILIPTAFGHDTQAPMAILNAGSELCAFEPRLGIDVDKLAVAQLP
GLVDEPPYGMCEAAVAQAWRRQQWPVLLPSVLAASWGAIRALWKHYPTLSVVHCSAHANL
MPPPEMSQPDQDTSYGSAAWVELLYQHMLPVIHVGLRSGSARAYAWLKAHHSPIFWAQDG
WDPQQVVASLPDQPVFLVVDCSVLDPSLAPAVHHPEPGGVSWPQLLQTCEAIFAARPVVG
LSLGGVAVGSATRQTARVVARLLNWLLACYALHSLKVTAQPQPVQTV
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atggcccagtggtccctccatcccagctcgcaatccaacgctagggtcattctcattccc
accgcctttggccacgatactcaggctccgatggccattctcaatgccggttcggagctg
tgtgccttcgagccgaggttggggatcgatgtggataagctggcggtggcgcagttgccg
gggctggtggatgagcctccctacggcatgtgtgaggcggcggtggctcaagcttggaga
cgacaacaatggccggtgctgttgccctcagtcttggctgccagttggggggccattcgt
gccctttggaagcactacccaactctgagtgtggtgcattgcagcgcccatgccaatctg
atgccgccgccggagatgagccagccggatcaagatacaagctatggcagtgctgcctgg
gtggagttgctctaccagcacatgctgccggtgatccatgtggggttgcgcagcggcagt
gcgcgcgcctacgcatggctgaaagcccaccacagcccaatattctgggcccaagatggc
tgggatccccagcaggtggtggcctctttgccggatcaaccggtgtttttggtggtggac
tgcagtgtgctggatccttccttagcgcccgcggtgcatcacccagagccagggggggtg
agttggccgcaactgttgcagacctgtgaggccatctttgccgctcgtcctgtggttggc
ctttcactgggaggggtggcggtgggatccgcaacacggcaaactgctcgcgtggtggcc
cgcctgctcaattggttgctggcctgctatgcccttcactccctgaaggtgaccgctcaa
ccgcaacctgtccagacggtttaa

DBGET integrated database retrieval system