KEGG   Synechococcus sp. JA-2-3B'a(2-13): CYB_2338Help
Entry
CYB_2338          CDS       T00319                                 

Definition
glycosyl hydrolase domain-containing protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
cyb  Synechococcus sp. JA-2-3B'a(2-13)
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cyb00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CYB_2338
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    CYB_2338
Enzymes [BR:cyb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     CYB_2338
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
CyanoBase: 
CYORF: 
UniProt: 
Position
2443451..2444986
Genome map
AA seq 511 aa AA seqDB search
MDPRAWSLEEKVGQLFLVYFEGAEFSSALEEMIRDYHVGGLIFYSIAGNIQTLPQVAQLI
AAAQAQALVPLWIAIDQEGGPVVRLTEGVTVFPSAMAVAAAGSLAKAEAMARAVGTELKS
LGFNLNFAPVVDVNSNPHNPIIGIRAFGSDPKQVTDYGLALWRGYRQAGILCTPKHFPGH
GDTDIDSHLGLPRVDRPLEALQTTELRPFQALIQAGAEAVMTAHVVMPALGSVRPATLAP
EVVSGWLRQRLGFQGLVLTDSLTMGAIARTYGIPEAAELAFRAGADVLVFGADPGFSPAI
QKEAYAHLLREFRAGRLSVEQLDRSVERILTLKRRYGLGSPCPPFPPAGLENHRALARQI
AQDSITLVRGSLPPLAPDPLLITPVPLLGELLQKACPAAQVFSIPLDPTPEQQRIAQEGA
QRAAQVLVGSLETWRHPAQRLLLGSLPPEKVIGLALGSPYDAFALPQIPVYLACYGTTPV
SLQALLQVLLGQIPAQGRLPVGSHLEGSWSR
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
gtggatcccagggcttggagccttgaggagaaagtggggcaactgtttctggtttatttt
gagggagctgagttttcctccgctctcgaggagatgatccgggactaccacgtgggcggg
ctgatcttctattcgattgccggcaacattcaaacgttgcctcaggtggcccagctcatt
gccgcggctcaggcacaagcccttgtccccctgtggatagccattgatcaagaggggggg
ccggtggtgcgccttaccgagggggtgacggtgttccccagcgccatggcagtggcagca
gcgggatccctggcaaaggcggaagctatggcccgtgcggtgggaacggagctgaaaagt
ttggggtttaacctcaacttcgcccctgttgtggacgtgaacagcaacccccacaacccc
atcatcggcatccgagcctttgggtcagacccgaaacaggtgacagattacggcctcgct
ctgtggcgcggctatcggcaagccgggatcctctgcacgcccaaacattttcccggtcat
ggggacaccgatatcgattcccacctggggttgccgcgggtggatcgtcccctggaggcg
ctacaaaccacggaattgcgcccgtttcaggctttgatccaggcaggggcagaggcggtg
atgacggcgcatgtagtgatgccggctctgggatccgtgcgaccggcaacgctggcccct
gaggtggtgtcgggctggctgcggcagaggctgggtttccagggtctcgtcctgacagat
tccctgaccatgggggccattgcccgcacctacggcattcccgaagcggcagaactggcc
tttagggcaggggccgatgtgctggtgtttggggcagatcccggctttagcccggccatc
caaaaagaagcctatgcccatctgctgcgggagttccgtgccggtcgtttgtcggttgag
cagttggatcggtcagtggagcgaattttgaccttgaagcggcgctacggattgggatcc
ccctgcccccctttcccccctgccggcttggaaaaccaccgggcactggcccgccaaatc
gcccaagacagcatcaccctagtacggggatccctgcctcccttggcccctgacccgctg
cttatcacccctgtacctttgttgggggagctgctgcaaaaagcctgtcccgctgcccaa
gtgttctccatccctctggatcccacccccgaacagcagcggattgcccaagaaggggct
caaagggctgcgcaggtgctggtgggatccctggagacgtggcggcatccggcgcagagg
ttgctgctgggatcccttccgccggaaaaggtgattgggttggctttgggatccccctac
gacgcctttgccctgccccagatcccggtctatttggcctgctacggcactacccccgtc
tctctacaggcgttgctgcaggtgttgttgggacagatcccggcccagggtcgcttgccg
gttggatcccacttggagggatcctggtcgcgttag

DBGET integrated database retrieval system