KEGG   Synechococcus sp. JA-2-3B'a(2-13): CYB_2343Help
Entry
CYB_2343          CDS       T00319                                 

Gene name
trpC
Definition
indole-3-glycerol-phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
cyb  Synechococcus sp. JA-2-3B'a(2-13)
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cyb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CYB_2343 (trpC)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CYB_2343 (trpC)
Enzymes [BR:cyb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     CYB_2343 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
2450470..2451390
Genome map
AA seq 306 aa AA seqDB search
MELQGEPLSIRRRSPAPPVVVASQVYQTTAPEAKPRHILEAIVWHKEQEVERQREQLPLK
ELQRQLDQAPPVRDFVAALTQSPHPISVIAEVKKASPSRGVLRDPFDPVAIAQSYEAGGA
SCLSVLTDERFFQGSGEYLRRIRQAVGIPILCKEFILYPYQILWARSLGADAVLLIAAIL
SDADLGYFLKLIRQLGMAALLEVHTSQELQRVLRLPQLQDSRGQVLIGINNRDLRTFAVD
LNTTRNLLAAHSELLGDLPVVSESGIHTPADLQQLRAWGVRSVLVGEALVTQPDPGQAVR
HLLSSQ
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggagctgcaaggtgagccgctttctattcgtcggcgttctcctgccccgccggtggtc
gtagcctctcaggtgtaccagacaacagcgccggaagccaaaccgcgccacattttggaa
gcgatcgtctggcataaagagcaggaggtggagcgccaacgggagcagcttcccctcaag
gaattgcaacggcaactggatcaagccccgccggtgcgggattttgtggcggccctcacc
cagtcgcctcaccctatctctgtgattgccgaggtcaaaaaagcctctcccagccgcggc
gttctccgggatccctttgacccggtggccattgcccagagctatgaggccggtggggcc
agttgcctctcggtgctcacagatgagcggttctttcagggcagcggcgagtatctgcgc
cggatccgtcaggcagtagggatccccatcctctgcaaggagttcatcctctacccctac
caaatcctctgggcccgcagcctgggggcagatgcggtgctcttgattgccgccattctc
tccgatgcggatttgggctactttctcaagctgattcggcaattgggcatggcggctctg
ctggaggtgcacacctcccaagagttgcagcgggtgttgcgtttgccccaactgcaagac
tccagggggcaggtgctcattggcatcaacaatcgcgatctgagaacctttgcggtggac
ttaaacacaacgcgcaacctgttggccgcccactcggagctccttggcgatctgcctgtg
gtcagcgagtccggcatccatacccccgccgatctgcagcagttgcgggcctggggggtg
cgctctgtgctcgtgggggaagcgctggtgacccagccggatcccggccaagctgtgcgc
cacctgttgtcatctcagtga

DBGET integrated database retrieval system